Cavia porcellus (domestic guinea pig): 100716085 Help Entry 100716085         CDS       T07777                                  Symbol Ccl22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04060   Cytokine-cytokine receptor interaction cpoc04061   Viral protein interaction with cytokine and cytokine receptor cpoc04062   Chemokine signaling pathway cpoc04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100716085 (Ccl22)    04061 Viral protein interaction with cytokine and cytokine receptor     100716085 (Ccl22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100716085 (Ccl22)    04062 Chemokine signaling pathway     100716085 (Ccl22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cpoc04052]     100716085 (Ccl22) Cytokines and neuropeptides [BR:cpoc04052]  Cytokines   Chemokines    100716085 (Ccl22) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100716085 NCBI-ProteinID:  XP_003472015 Ensembl:  ENSCPOG00000033528 UniProt:  A0A286Y638 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MASLQTPLLAVLILLSVMLQATDAGPYGANVEDSICCRDFVRYPLPPRVVKDFYWTSDSC RRAGVVLQTVKDREICANPKLPWVKKILQKLSP NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagcctgcagactccgctcctggctgtcctcatcctcctctcagtgatgcttcag gcaactgatgcaggtccctacggggccaacgtagaggacagcatctgctgccgggacttt gtccgctacccgctgccgccgcgcgtggtgaaggacttctactggacctcagactcctgc cgcagggctggcgtcgtcctgcaaaccgtcaaagaccgggagatctgtgctaaccccaaa ctgccctgggtaaagaagattctccagaagctgagcccatga

DBGET integrated database retrieval system