Cavia porcellus (domestic guinea pig): 100717510 Help Entry 100717510         CDS       T07777                                  Name (RefSeq) histone H2B type 2-E-like   KO K11252   histone H2B Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04613   Neutrophil extracellular trap formation cpoc05034   Alcoholism cpoc05203   Viral carcinogenesis cpoc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cpoc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100717510  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100717510   09163 Immune disease    05322 Systemic lupus erythematosus     100717510   09165 Substance dependence    05034 Alcoholism     100717510  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cpoc03036]     100717510   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cpoc04147]     100717510 Chromosome and associated proteins [BR:cpoc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100717510 Exosome [BR:cpoc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100717510 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa Motif Other DBs NCBI-GeneID:  100717510 NCBI-ProteinID:  XP_005007815 Ensembl:  ENSCPOG00000030965 UniProt:  A0A286XDV6 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GITNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccggagccggccaagtccgctccggctcccaagaagggctccaaaaaggctgtcacc aaagcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccatc tatgtgtacaaggtgctgaagcaggtgcaccccgacacgggcatctcgtccaaggccatg ggcatcacgaactccttcgtcaatgacatcttcgagcgcatcgctggcgaggcgtctcgc ctggcacactacaacaagcgctcgaccatcacgtcccgcgagatccagacggccgtgcgc ctgctgctgccgggcgagctggccaagcacgccgtgtcggagggcaccaaggcggtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system