Cavia porcellus (domestic guinea pig): 100717524 Help Entry 100717524         CDS       T07777                                  Symbol Brk1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04810   Regulation of actin cytoskeleton cpoc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cpoc00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100717524 (Brk1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100717524 (Brk1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil Motif Other DBs NCBI-GeneID:  100717524 NCBI-ProteinID:  XP_003464128 Ensembl:  ENSCPOG00000038719 UniProt:  A0A286XVD6 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIELITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggctggacaggaggacccggtgcagcgggagatccaccaggactgggcgaacagggaa tacattgagctcatcaccagcagcattaagaagatcgcggactttctcaactcgttcgat atgtcttgccgttcaagactcgcaacgctgaatgagaagctgacagccctggagcggagg atagaatacatcgaagctcgggtgacgaaaggcgagactctcacctag

DBGET integrated database retrieval system