Cavia porcellus (domestic guinea pig): 100717681 Help Entry 100717681         CDS       T07777                                  Symbol Pfn2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04015   Rap1 signaling pathway cpoc04810   Regulation of actin cytoskeleton cpoc05014   Amyotrophic lateral sclerosis cpoc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100717681 (Pfn2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100717681 (Pfn2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100717681 (Pfn2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100717681 (Pfn2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cpoc04131]     100717681 (Pfn2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cpoc04812]     100717681 (Pfn2)    04147 Exosome [BR:cpoc04147]     100717681 (Pfn2) Membrane trafficking [BR:cpoc04131]  Others   Actin-binding proteins    Others     100717681 (Pfn2) Cytoskeleton proteins [BR:cpoc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100717681 (Pfn2) Exosome [BR:cpoc04147]  Exosomal proteins   Proteins found in most exosomes    100717681 (Pfn2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100717681 NCBI-ProteinID:  XP_003476820 Ensembl:  ENSCPOG00000034416 UniProt:  A0A286XW11 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcattacgccaatagaaatagacatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggtgcaaagaagtgttcagtgatcagagatagtctatatgtc gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacgtacaat gttgctgtcgggagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system