Cavia porcellus (domestic guinea pig): 100720397 Help Entry 100720397         CDS       T07777                                  Symbol Defb1 Name (RefSeq) beta-defensin 1   KO K23125   beta-defensin 1 Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc02010   ABC transporters cpoc05150   Staphylococcus aureus infection Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     100720397 (Defb1)  09160 Human Diseases   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     100720397 (Defb1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:cpoc02000]     100720397 (Defb1)    03037 Cilium and associated proteins [BR:cpoc03037]     100720397 (Defb1) Transporters [BR:cpoc02000]  Other transporters   Pores ion channels [TC:1]    100720397 (Defb1) Cilium and associated proteins [BR:cpoc03037]  Motile cilia and associated proteins   Sperm associated proteins    100720397 (Defb1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Defensin_beta Motif Other DBs NCBI-GeneID:  100720397 NCBI-ProteinID:  XP_003479753 LinkDB All DBs Position Unknown AA seq 67 aa AA seqDB search MRTHCLLLLAFCFLFCQMAPGTALTSLGHRSDHYQCVRNGGFCLYSACPMFSKVVGTCYN GKAKCCT NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgaggacccactgcctgctgctgctcgccttctgcttcctcttctgccagatggcccca ggtaccgctctcacaagtctcggccacagatcggaccattaccagtgtgtgaggaacgga gggttctgtttgtactctgcttgtcccatgttttccaaagtcgttggcacctgctacaac gggaaggcgaagtgctgcacctga

DBGET integrated database retrieval system