Cavia porcellus (domestic guinea pig): 100721543 Help Entry 100721543         CDS       T07777                                  Symbol Csnk2b Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc03008   Ribosome biogenesis in eukaryotes cpoc03083   Polycomb repressive complex cpoc04064   NF-kappa B signaling pathway cpoc04137   Mitophagy - animal cpoc04310   Wnt signaling pathway cpoc04520   Adherens junction cpoc05010   Alzheimer disease cpoc05020   Prion disease cpoc05022   Pathways of neurodegeneration - multiple diseases cpoc05162   Measles cpoc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:cpoc00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     100721543 (Csnk2b)   09126 Chromosome    03083 Polycomb repressive complex     100721543 (Csnk2b)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     100721543 (Csnk2b)    04064 NF-kappa B signaling pathway     100721543 (Csnk2b)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     100721543 (Csnk2b)   09144 Cellular community - eukaryotes    04520 Adherens junction     100721543 (Csnk2b)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100721543 (Csnk2b)   09172 Infectious disease: viral    05162 Measles     100721543 (Csnk2b)   09164 Neurodegenerative disease    05010 Alzheimer disease     100721543 (Csnk2b)    05020 Prion disease     100721543 (Csnk2b)    05022 Pathways of neurodegeneration - multiple diseases     100721543 (Csnk2b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:cpoc03009]     100721543 (Csnk2b)    03036 Chromosome and associated proteins [BR:cpoc03036]     100721543 (Csnk2b) Ribosome biogenesis [BR:cpoc03009]  Eukaryotic type   90S particles    Kinase     100721543 (Csnk2b) Chromosome and associated proteins [BR:cpoc03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      100721543 (Csnk2b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  100721543 NCBI-ProteinID:  XP_003474026 Ensembl:  ENSCPOG00000010792 UniProt:  A0A286XQ20 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagtagctccgaagaggtgtcctggatttcctggttctgtggactccgtggcaatgaa ttcttctgtgaggtggatgaagactacatccaagataaatttaatcttacggggcttaat gagcaggtgcctcactaccggcaagctctagacatgatcttggacctggagcctgatgaa gagctggaagacaaccccaaccagagcgacctgatcgagcaggcagctgaaatgctttat ggattgatccacgctcgctacatcctcactaaccgtggcatcgcccagatgttggaaaag taccagcagggagacttcggctactgtccccgtgtgtactgtgagaaccagccaatgctt cccatcggcctttcggacatcccaggcgaggccatggtgaagctctactgccccaagtgc atggatgtgtacacacccaagtcatcaaggcaccaccacacagatggcgcctactttggc accggtttcccccacatgctcttcatggtgcatcccgagtaccggcccaagcgacctgcc aaccagtttgtgcccaggctctacggtttcaagatccatccgatggcttaccagctgcag ctgcaggctgccagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system