Cavia porcellus (domestic guinea pig): 100721839 Help Entry 100721839         CDS       T07777                                  Symbol Rab7a Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04137   Mitophagy - animal cpoc04140   Autophagy - animal cpoc04144   Endocytosis cpoc04145   Phagosome cpoc04148   Efferocytosis cpoc05132   Salmonella infection cpoc05146   Amoebiasis cpoc05152   Tuberculosis Brite KEGG Orthology (KO) [BR:cpoc00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100721839 (Rab7a)    04145 Phagosome     100721839 (Rab7a)    04140 Autophagy - animal     100721839 (Rab7a)    04137 Mitophagy - animal     100721839 (Rab7a)    04148 Efferocytosis     100721839 (Rab7a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100721839 (Rab7a)    05152 Tuberculosis     100721839 (Rab7a)   09174 Infectious disease: parasitic    05146 Amoebiasis     100721839 (Rab7a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cpoc04131]     100721839 (Rab7a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cpoc04147]     100721839 (Rab7a)    04031 GTP-binding proteins [BR:cpoc04031]     100721839 (Rab7a) Membrane trafficking [BR:cpoc04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     100721839 (Rab7a) Exosome [BR:cpoc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100721839 (Rab7a)   Exosomal proteins of other body fluids (saliva and urine)    100721839 (Rab7a)   Exosomal proteins of colorectal cancer cells    100721839 (Rab7a)   Exosomal proteins of bladder cancer cells    100721839 (Rab7a) GTP-binding proteins [BR:cpoc04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     100721839 (Rab7a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  100721839 NCBI-ProteinID:  XP_003461541 Ensembl:  ENSCPOG00000034570 UniProt:  A0A286Y502 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKPSAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctcaaggaagaaagtgttgctgaaggttatcatcctgggcgactcaggggtcgga aagacatcacttatgaatcagtatgtgaacaagaaattcagtaaccagtacaaagccaca ataggagcagactttctgacgaaggaggtgatggtggacgacagactagtcaccatgcag atttgggacacagccggtcaggaaaggttccagtcccttggcgtagccttctaccgcggc gcagactgctgtgtgctggtgttcgatgtaacagcccccaacacattcaagaccctggac agctggagggatgagtttctcatccaggccagcccccgggaccctgagaacttccccttt gtcgtgctggggaacaagatcgacctcgaaaaccgacaagtggccacgaagagggcacag gcctggtgctacagcaaaaacaacattccctacttcgagaccagtgccaaggaagccatc aatgtggagcaggcgttccagacaatcgcccggaacgcgctcaagcaggagacagaggtg gagctgtacaatgaattccccgaacccatcaaactggacaagaacgaccgggccaagccc tcggccgagagctgcagctgctga

DBGET integrated database retrieval system