Cavia porcellus (domestic guinea pig): 100721882 Help Entry 100721882         CDS       T07777                                  Symbol Ppp3r1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04010   MAPK signaling pathway cpoc04020   Calcium signaling pathway cpoc04022   cGMP-PKG signaling pathway cpoc04114   Oocyte meiosis cpoc04218   Cellular senescence cpoc04310   Wnt signaling pathway cpoc04360   Axon guidance cpoc04370   VEGF signaling pathway cpoc04380   Osteoclast differentiation cpoc04625   C-type lectin receptor signaling pathway cpoc04650   Natural killer cell mediated cytotoxicity cpoc04658   Th1 and Th2 cell differentiation cpoc04659   Th17 cell differentiation cpoc04660   T cell receptor signaling pathway cpoc04662   B cell receptor signaling pathway cpoc04720   Long-term potentiation cpoc04724   Glutamatergic synapse cpoc04921   Oxytocin signaling pathway cpoc04922   Glucagon signaling pathway cpoc04924   Renin secretion cpoc05010   Alzheimer disease cpoc05014   Amyotrophic lateral sclerosis cpoc05020   Prion disease cpoc05022   Pathways of neurodegeneration - multiple diseases cpoc05031   Amphetamine addiction cpoc05152   Tuberculosis cpoc05163   Human cytomegalovirus infection cpoc05166   Human T-cell leukemia virus 1 infection cpoc05167   Kaposi sarcoma-associated herpesvirus infection cpoc05170   Human immunodeficiency virus 1 infection cpoc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer cpoc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100721882 (Ppp3r1)    04310 Wnt signaling pathway     100721882 (Ppp3r1)    04370 VEGF signaling pathway     100721882 (Ppp3r1)    04020 Calcium signaling pathway     100721882 (Ppp3r1)    04022 cGMP-PKG signaling pathway     100721882 (Ppp3r1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     100721882 (Ppp3r1)    04218 Cellular senescence     100721882 (Ppp3r1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100721882 (Ppp3r1)    04650 Natural killer cell mediated cytotoxicity     100721882 (Ppp3r1)    04660 T cell receptor signaling pathway     100721882 (Ppp3r1)    04658 Th1 and Th2 cell differentiation     100721882 (Ppp3r1)    04659 Th17 cell differentiation     100721882 (Ppp3r1)    04662 B cell receptor signaling pathway     100721882 (Ppp3r1)   09152 Endocrine system    04922 Glucagon signaling pathway     100721882 (Ppp3r1)    04921 Oxytocin signaling pathway     100721882 (Ppp3r1)    04924 Renin secretion     100721882 (Ppp3r1)   09156 Nervous system    04724 Glutamatergic synapse     100721882 (Ppp3r1)    04720 Long-term potentiation     100721882 (Ppp3r1)   09158 Development and regeneration    04360 Axon guidance     100721882 (Ppp3r1)    04380 Osteoclast differentiation     100721882 (Ppp3r1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100721882 (Ppp3r1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100721882 (Ppp3r1)    05170 Human immunodeficiency virus 1 infection     100721882 (Ppp3r1)    05163 Human cytomegalovirus infection     100721882 (Ppp3r1)    05167 Kaposi sarcoma-associated herpesvirus infection     100721882 (Ppp3r1)   09171 Infectious disease: bacterial    05152 Tuberculosis     100721882 (Ppp3r1)   09164 Neurodegenerative disease    05010 Alzheimer disease     100721882 (Ppp3r1)    05014 Amyotrophic lateral sclerosis     100721882 (Ppp3r1)    05020 Prion disease     100721882 (Ppp3r1)    05022 Pathways of neurodegeneration - multiple diseases     100721882 (Ppp3r1)   09165 Substance dependence    05031 Amphetamine addiction     100721882 (Ppp3r1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100721882 (Ppp3r1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cpoc01009]     100721882 (Ppp3r1) Protein phosphatases and associated proteins [BR:cpoc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100721882 (Ppp3r1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  100721882 NCBI-ProteinID:  XP_023420568 Ensembl:  ENSCPOG00000036560 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgtgctcacactttgatgctgatgaaattaaaaggctaggaaaaagatttaagaagctt gatttggacaattctggttctttgagtgtggaagagtttatgtctttgcctgaattacaa cagaatcctttagtacagcgagtaatagatatattcgacacagacgggaatggagaagta gacttcaaagaattcattgaaggggtctctcagttcagtgtcaaaggagataaggagcaa aagttgaggtttgctttccgtatctatgacatggataaagatggctatatttccaatggg gagctcttccaggttttgaagatgatggtggggaacaacctgaaagacacacaattacaa caaattgtagacaaaactataataaatgcagataaggatggagatggaagaatatccttt gaagaattctgtgctgttgtaggtggcctagatatccacaaaaagatggtggtagatgtg tga

DBGET integrated database retrieval system