Cavia porcellus (domestic guinea pig): 100722591 Help Entry 100722591         CDS       T07777                                  Symbol S100a10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04382   Cornified envelope formation cpoc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cpoc00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     100722591 (S100a10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100722591 (S100a10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cpoc04147]     100722591 (S100a10) Exosome [BR:cpoc04147]  Exosomal proteins   Exosomal proteins of microglial cells    100722591 (S100a10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EFhand_Ca_insen EF-hand_1 EF-hand_7 Motif Other DBs NCBI-GeneID:  100722591 NCBI-ProteinID:  XP_003479094 Ensembl:  ENSCPOG00000033136 UniProt:  A0A286XZY3 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKCYLTKEDLRLLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKKCKK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgccttcccagatggaacacgccatggaaaccatgatgtttacgtttcacaaatttgct ggagacaaatgctacttaaccaaggaagacttgagattactcatggaaaaggagttccct ggatttttggaaaatcagaaagaccctctggctgtggacaaaatcatgaaggacctggac cagtgccgagacggcaaagtgggctttcagagcttcttttcactaattgcaggcctcacc attgcgtgcaatgattatttcgtggtacacatgaagaaatgcaagaagtag

DBGET integrated database retrieval system