Cavia porcellus (domestic guinea pig): 100723189 Help Entry 100723189         CDS       T07777                                  Symbol Nfkbia Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04024   cAMP signaling pathway cpoc04062   Chemokine signaling pathway cpoc04064   NF-kappa B signaling pathway cpoc04210   Apoptosis cpoc04380   Osteoclast differentiation cpoc04620   Toll-like receptor signaling pathway cpoc04621   NOD-like receptor signaling pathway cpoc04622   RIG-I-like receptor signaling pathway cpoc04623   Cytosolic DNA-sensing pathway cpoc04625   C-type lectin receptor signaling pathway cpoc04657   IL-17 signaling pathway cpoc04658   Th1 and Th2 cell differentiation cpoc04659   Th17 cell differentiation cpoc04660   T cell receptor signaling pathway cpoc04662   B cell receptor signaling pathway cpoc04668   TNF signaling pathway cpoc04722   Neurotrophin signaling pathway cpoc04920   Adipocytokine signaling pathway cpoc04926   Relaxin signaling pathway cpoc04931   Insulin resistance cpoc04936   Alcoholic liver disease cpoc05132   Salmonella infection cpoc05134   Legionellosis cpoc05135   Yersinia infection cpoc05140   Leishmaniasis cpoc05142   Chagas disease cpoc05145   Toxoplasmosis cpoc05160   Hepatitis C cpoc05161   Hepatitis B cpoc05162   Measles cpoc05163   Human cytomegalovirus infection cpoc05164   Influenza A cpoc05166   Human T-cell leukemia virus 1 infection cpoc05167   Kaposi sarcoma-associated herpesvirus infection cpoc05168   Herpes simplex virus 1 infection cpoc05169   Epstein-Barr virus infection cpoc05170   Human immunodeficiency virus 1 infection cpoc05171   Coronavirus disease - COVID-19 cpoc05200   Pathways in cancer cpoc05203   Viral carcinogenesis cpoc05208   Chemical carcinogenesis - reactive oxygen species cpoc05215   Prostate cancer cpoc05220   Chronic myeloid leukemia cpoc05222   Small cell lung cancer cpoc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer cpoc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100723189 (Nfkbia)    04668 TNF signaling pathway     100723189 (Nfkbia)    04024 cAMP signaling pathway     100723189 (Nfkbia)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100723189 (Nfkbia)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100723189 (Nfkbia)    04621 NOD-like receptor signaling pathway     100723189 (Nfkbia)    04622 RIG-I-like receptor signaling pathway     100723189 (Nfkbia)    04623 Cytosolic DNA-sensing pathway     100723189 (Nfkbia)    04625 C-type lectin receptor signaling pathway     100723189 (Nfkbia)    04660 T cell receptor signaling pathway     100723189 (Nfkbia)    04658 Th1 and Th2 cell differentiation     100723189 (Nfkbia)    04659 Th17 cell differentiation     100723189 (Nfkbia)    04657 IL-17 signaling pathway     100723189 (Nfkbia)    04662 B cell receptor signaling pathway     100723189 (Nfkbia)    04062 Chemokine signaling pathway     100723189 (Nfkbia)   09152 Endocrine system    04920 Adipocytokine signaling pathway     100723189 (Nfkbia)    04926 Relaxin signaling pathway     100723189 (Nfkbia)   09156 Nervous system    04722 Neurotrophin signaling pathway     100723189 (Nfkbia)   09158 Development and regeneration    04380 Osteoclast differentiation     100723189 (Nfkbia)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100723189 (Nfkbia)    05208 Chemical carcinogenesis - reactive oxygen species     100723189 (Nfkbia)    05203 Viral carcinogenesis     100723189 (Nfkbia)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100723189 (Nfkbia)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     100723189 (Nfkbia)    05215 Prostate cancer     100723189 (Nfkbia)    05222 Small cell lung cancer     100723189 (Nfkbia)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100723189 (Nfkbia)    05170 Human immunodeficiency virus 1 infection     100723189 (Nfkbia)    05161 Hepatitis B     100723189 (Nfkbia)    05160 Hepatitis C     100723189 (Nfkbia)    05171 Coronavirus disease - COVID-19     100723189 (Nfkbia)    05164 Influenza A     100723189 (Nfkbia)    05162 Measles     100723189 (Nfkbia)    05168 Herpes simplex virus 1 infection     100723189 (Nfkbia)    05163 Human cytomegalovirus infection     100723189 (Nfkbia)    05167 Kaposi sarcoma-associated herpesvirus infection     100723189 (Nfkbia)    05169 Epstein-Barr virus infection     100723189 (Nfkbia)   09171 Infectious disease: bacterial    05132 Salmonella infection     100723189 (Nfkbia)    05135 Yersinia infection     100723189 (Nfkbia)    05134 Legionellosis     100723189 (Nfkbia)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100723189 (Nfkbia)    05140 Leishmaniasis     100723189 (Nfkbia)    05142 Chagas disease     100723189 (Nfkbia)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100723189 (Nfkbia)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100723189 (Nfkbia)    04931 Insulin resistance     100723189 (Nfkbia)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:cpoc03000]     100723189 (Nfkbia)    04131 Membrane trafficking [BR:cpoc04131]     100723189 (Nfkbia) Transcription factors [BR:cpoc03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     100723189 (Nfkbia) Membrane trafficking [BR:cpoc04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     100723189 (Nfkbia) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  100723189 NCBI-ProteinID:  XP_003471927 Ensembl:  ENSCPOG00000005455 UniProt:  H0V5H9 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MFQPAERVQEWAMEGPRDVLKKERLLDDRHDSGLDSMKDEEYEQMMKELQEIRLEPHEVL RGAEPWKQQLTEDGDSFLHLAIIHEEKVLTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TKQPEITQALLEAGCDPELRDFRGNTPLHLACEQGCLASVAVLTQTCTTQHLHSILQATN YNGHTCLHLASIHGYLAIVERLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTQIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVFGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagccggccgagcgcgtccaggagtgggccatggaggggccccgggacgtgctc aagaaggagcgcctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagatgatgaaggagctgcaggagatccgcctggagccgcatgaggtgctg cgaggcgcggagccctggaagcagcagctgacggaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggtgctgaccatggaagtgatccgccaggtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagactccactgcacttggctgtgatc accaagcagcctgaaattactcaggcacttctggaagctggctgtgatcctgagctccgg gactttcgaggaaacacccccctacaccttgcctgtgagcagggctgcctggccagtgtc gcggtgctgacgcagacctgcaccacacaacacctccactccatcctgcaggccactaac tacaatggccacacgtgtctgcacttagcttctatccatggctacctggccatcgtggag cgcttggtgtccttgggtgctgatgtcaatgcccaggagccctgcaatggccggacggca ctccacctcgcggtggaccttcagaatcctgatctcgtgtcactcttgttgaagtgtggg gctgatgtcaacagagtcacctaccaaggttactccccatatcagctcacctggggccgg ccaagcacccagatacagcagcagctgggtcagctgaccctcgaaaaccttcagatgctg ccagagagcgaggatgaggagagctatgacacagagtcagagttcacagaggatgagctg ccatatgatgactgtgtgtttggaggtcagcgtctgacattatga

DBGET integrated database retrieval system