Cavia porcellus (domestic guinea pig): 100723625 Help Entry 100723625         CDS       T07777                                  Symbol Pfn1 Name (RefSeq) profilin-1   KO K05759   profilin Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04015   Rap1 signaling pathway cpoc04810   Regulation of actin cytoskeleton cpoc05014   Amyotrophic lateral sclerosis cpoc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100723625 (Pfn1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100723625 (Pfn1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100723625 (Pfn1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100723625 (Pfn1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cpoc04131]     100723625 (Pfn1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cpoc04812]     100723625 (Pfn1)    04147 Exosome [BR:cpoc04147]     100723625 (Pfn1) Membrane trafficking [BR:cpoc04131]  Others   Actin-binding proteins    Others     100723625 (Pfn1) Cytoskeleton proteins [BR:cpoc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100723625 (Pfn1) Exosome [BR:cpoc04147]  Exosomal proteins   Proteins found in most exosomes    100723625 (Pfn1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100723625 NCBI-ProteinID:  XP_003466341 Ensembl:  ENSCPOG00000039087 UniProt:  A0A286XW34 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKIFVNITPAEVAVLVGKDRASFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRAQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctacaaggactcgccctctgtctgggccgccgtccccgggaaaatcttc gtcaacatcacgccagctgaagtcgctgtcctggttggcaaagaccgggcaagttttttt gtgaatgggctgacacttgggggccagaagtgttctgtgatccgggactcactgctacag gatggggaatttaccatggatcttcgtaccaagagcaccggtggagcccctaccttcaac gtcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccat ggtggtatgatcaacaagaaatgttacgaaatggcctcccacctgcggcgtgcccagtac tga

DBGET integrated database retrieval system