Cavia porcellus (domestic guinea pig): 100723790 Help Entry 100723790         CDS       T07777                                  Symbol Rab5a Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04014   Ras signaling pathway cpoc04137   Mitophagy - animal cpoc04144   Endocytosis cpoc04145   Phagosome cpoc04148   Efferocytosis cpoc04962   Vasopressin-regulated water reabsorption cpoc05014   Amyotrophic lateral sclerosis cpoc05022   Pathways of neurodegeneration - multiple diseases cpoc05132   Salmonella infection cpoc05146   Amoebiasis cpoc05152   Tuberculosis Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100723790 (Rab5a)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100723790 (Rab5a)    04145 Phagosome     100723790 (Rab5a)    04137 Mitophagy - animal     100723790 (Rab5a)    04148 Efferocytosis     100723790 (Rab5a)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     100723790 (Rab5a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100723790 (Rab5a)    05152 Tuberculosis     100723790 (Rab5a)   09174 Infectious disease: parasitic    05146 Amoebiasis     100723790 (Rab5a)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100723790 (Rab5a)    05022 Pathways of neurodegeneration - multiple diseases     100723790 (Rab5a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cpoc04131]     100723790 (Rab5a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cpoc04147]     100723790 (Rab5a)    04031 GTP-binding proteins [BR:cpoc04031]     100723790 (Rab5a) Membrane trafficking [BR:cpoc04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     100723790 (Rab5a)  Endosome - Lysosome transport     100723790 (Rab5a) Exosome [BR:cpoc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100723790 (Rab5a)   Exosomal proteins of other body fluids (saliva and urine)    100723790 (Rab5a)   Exosomal proteins of colorectal cancer cells    100723790 (Rab5a)   Exosomal proteins of bladder cancer cells    100723790 (Rab5a) GTP-binding proteins [BR:cpoc04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     100723790 (Rab5a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 BrnT_toxin MCR_beta TAGT Motif Other DBs NCBI-GeneID:  100723790 NCBI-ProteinID:  XP_003480220 Ensembl:  ENSCPOG00000005322 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGSCFSTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYAEDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacctaatgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagcctggtgcttcgtttt gtgaaaggccagtttcatgaatttcaagagagtaccattggcagctgcttttctactcaa actgtgtgtcttgatgacacaacagtaaagtttgaaatatgggatacagctggtcaagaa agataccatagtctagcaccaatgtactacagaggagcccaagcagccatagttgtatat gatatcacaaatgaggaatcatttgcaagagcaaaaaactgggttaaagaactccagagg caagcaagtcctaacattgtaatagctttatcgggaaacaaggctgacctagcaaataaa agagctgtagacttccaggaagcacagtcctatgcagaggacaacagtttattattcatg gaaacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag ttgccaaagaacgagccacagaatccaggagcaaattctgctagaggaagaggagtagac ctcacggaacctacacagccaaccagaagtcagtgttgtagtaactaa

DBGET integrated database retrieval system