Cavia porcellus (domestic guinea pig): 100724988 Help Entry 100724988         CDS       T07777                                  Name (RefSeq) interferon alpha-17-like   KO K05414   interferon alpha Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04060   Cytokine-cytokine receptor interaction cpoc04151   PI3K-Akt signaling pathway cpoc04217   Necroptosis cpoc04620   Toll-like receptor signaling pathway cpoc04621   NOD-like receptor signaling pathway cpoc04622   RIG-I-like receptor signaling pathway cpoc04623   Cytosolic DNA-sensing pathway cpoc04630   JAK-STAT signaling pathway cpoc04650   Natural killer cell mediated cytotoxicity cpoc04936   Alcoholic liver disease cpoc05152   Tuberculosis cpoc05160   Hepatitis C cpoc05161   Hepatitis B cpoc05162   Measles cpoc05163   Human cytomegalovirus infection cpoc05164   Influenza A cpoc05165   Human papillomavirus infection cpoc05167   Kaposi sarcoma-associated herpesvirus infection cpoc05168   Herpes simplex virus 1 infection cpoc05169   Epstein-Barr virus infection cpoc05170   Human immunodeficiency virus 1 infection cpoc05171   Coronavirus disease - COVID-19 cpoc05200   Pathways in cancer cpoc05320   Autoimmune thyroid disease cpoc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100724988    04151 PI3K-Akt signaling pathway     100724988   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100724988  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100724988  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100724988    04621 NOD-like receptor signaling pathway     100724988    04622 RIG-I-like receptor signaling pathway     100724988    04623 Cytosolic DNA-sensing pathway     100724988    04650 Natural killer cell mediated cytotoxicity     100724988  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100724988   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100724988    05161 Hepatitis B     100724988    05160 Hepatitis C     100724988    05171 Coronavirus disease - COVID-19     100724988    05164 Influenza A     100724988    05162 Measles     100724988    05168 Herpes simplex virus 1 infection     100724988    05163 Human cytomegalovirus infection     100724988    05167 Kaposi sarcoma-associated herpesvirus infection     100724988    05169 Epstein-Barr virus infection     100724988    05165 Human papillomavirus infection     100724988   09171 Infectious disease: bacterial    05152 Tuberculosis     100724988   09163 Immune disease    05320 Autoimmune thyroid disease     100724988   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100724988   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100724988  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cpoc04052]     100724988 Cytokines and neuropeptides [BR:cpoc04052]  Cytokines   Interferons    100724988 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100724988 NCBI-ProteinID:  XP_012998236 UniProt:  A0A7R8C3I8 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MALPFAFLVNLVMLLCSSTFSLACNLPQTHSQGNRNASILLGQMRRLSTFSCLKHRQDFG LAQLDFDGKQVQKTQALSVLQEMITQTLILFKSQNSSAAWNQSLLDSFCTGLYEQLNDLE ACLTQETGLKEPLLMHEDYRLVVRKYFHRIAVYLKEKSYSPCAWEVVRAEIDRSFSASEE LARKMQD NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggccttgccctttgcttttctggtgaacttggtgatgcttctctgcagttcaaccttc tctctggcctgcaacctgcctcagactcacagccaggggaacaggaatgcctcgattctc ctgggacaaatgaggagactttccactttctcctgcctgaagcacagacaggactttggc ttggcccagctggactttgacggcaagcaggtgcagaaaactcaagccctctctgtcctc caagagatgatcacgcagaccctcatcctcttcaaatcacagaactcatctgctgcctgg aaccagagtctccttgacagcttctgcactggcctctatgagcagctgaatgacctggag gcctgcctgactcaggagacagggctgaaagagcctctcctgatgcatgaggactacaga ctggttgtgaggaaatacttccacaggatcgctgtctacctgaaggagaagagctacagc ccttgtgcctgggaggtggtcagagcagaaatcgacagatccttctctgcatcagaagaa ctggcaagaaagatgcaggactaa

DBGET integrated database retrieval system