KEGG   Cavia porcellus (domestic guinea pig): 100725692
Entry
100725692         CDS       T07777                                 
Symbol
Mapk3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cpoc  Cavia porcellus (domestic guinea pig)
Pathway
cpoc01521  EGFR tyrosine kinase inhibitor resistance
cpoc01522  Endocrine resistance
cpoc01524  Platinum drug resistance
cpoc04010  MAPK signaling pathway
cpoc04012  ErbB signaling pathway
cpoc04014  Ras signaling pathway
cpoc04015  Rap1 signaling pathway
cpoc04022  cGMP-PKG signaling pathway
cpoc04024  cAMP signaling pathway
cpoc04062  Chemokine signaling pathway
cpoc04066  HIF-1 signaling pathway
cpoc04068  FoxO signaling pathway
cpoc04071  Sphingolipid signaling pathway
cpoc04072  Phospholipase D signaling pathway
cpoc04114  Oocyte meiosis
cpoc04140  Autophagy - animal
cpoc04148  Efferocytosis
cpoc04150  mTOR signaling pathway
cpoc04151  PI3K-Akt signaling pathway
cpoc04210  Apoptosis
cpoc04218  Cellular senescence
cpoc04261  Adrenergic signaling in cardiomyocytes
cpoc04270  Vascular smooth muscle contraction
cpoc04350  TGF-beta signaling pathway
cpoc04360  Axon guidance
cpoc04370  VEGF signaling pathway
cpoc04371  Apelin signaling pathway
cpoc04380  Osteoclast differentiation
cpoc04510  Focal adhesion
cpoc04520  Adherens junction
cpoc04540  Gap junction
cpoc04550  Signaling pathways regulating pluripotency of stem cells
cpoc04611  Platelet activation
cpoc04613  Neutrophil extracellular trap formation
cpoc04620  Toll-like receptor signaling pathway
cpoc04621  NOD-like receptor signaling pathway
cpoc04625  C-type lectin receptor signaling pathway
cpoc04650  Natural killer cell mediated cytotoxicity
cpoc04657  IL-17 signaling pathway
cpoc04658  Th1 and Th2 cell differentiation
cpoc04659  Th17 cell differentiation
cpoc04660  T cell receptor signaling pathway
cpoc04662  B cell receptor signaling pathway
cpoc04664  Fc epsilon RI signaling pathway
cpoc04666  Fc gamma R-mediated phagocytosis
cpoc04668  TNF signaling pathway
cpoc04713  Circadian entrainment
cpoc04720  Long-term potentiation
cpoc04722  Neurotrophin signaling pathway
cpoc04723  Retrograde endocannabinoid signaling
cpoc04724  Glutamatergic synapse
cpoc04725  Cholinergic synapse
cpoc04726  Serotonergic synapse
cpoc04730  Long-term depression
cpoc04810  Regulation of actin cytoskeleton
cpoc04910  Insulin signaling pathway
cpoc04912  GnRH signaling pathway
cpoc04914  Progesterone-mediated oocyte maturation
cpoc04915  Estrogen signaling pathway
cpoc04916  Melanogenesis
cpoc04917  Prolactin signaling pathway
cpoc04919  Thyroid hormone signaling pathway
cpoc04921  Oxytocin signaling pathway
cpoc04926  Relaxin signaling pathway
cpoc04928  Parathyroid hormone synthesis, secretion and action
cpoc04929  GnRH secretion
cpoc04930  Type II diabetes mellitus
cpoc04933  AGE-RAGE signaling pathway in diabetic complications
cpoc04934  Cushing syndrome
cpoc04935  Growth hormone synthesis, secretion and action
cpoc04960  Aldosterone-regulated sodium reabsorption
cpoc05010  Alzheimer disease
cpoc05020  Prion disease
cpoc05022  Pathways of neurodegeneration - multiple diseases
cpoc05034  Alcoholism
cpoc05132  Salmonella infection
cpoc05133  Pertussis
cpoc05135  Yersinia infection
cpoc05140  Leishmaniasis
cpoc05142  Chagas disease
cpoc05145  Toxoplasmosis
cpoc05152  Tuberculosis
cpoc05160  Hepatitis C
cpoc05161  Hepatitis B
cpoc05163  Human cytomegalovirus infection
cpoc05164  Influenza A
cpoc05165  Human papillomavirus infection
cpoc05166  Human T-cell leukemia virus 1 infection
cpoc05167  Kaposi sarcoma-associated herpesvirus infection
cpoc05170  Human immunodeficiency virus 1 infection
cpoc05171  Coronavirus disease - COVID-19
cpoc05200  Pathways in cancer
cpoc05203  Viral carcinogenesis
cpoc05205  Proteoglycans in cancer
cpoc05206  MicroRNAs in cancer
cpoc05207  Chemical carcinogenesis - receptor activation
cpoc05208  Chemical carcinogenesis - reactive oxygen species
cpoc05210  Colorectal cancer
cpoc05211  Renal cell carcinoma
cpoc05212  Pancreatic cancer
cpoc05213  Endometrial cancer
cpoc05214  Glioma
cpoc05215  Prostate cancer
cpoc05216  Thyroid cancer
cpoc05218  Melanoma
cpoc05219  Bladder cancer
cpoc05220  Chronic myeloid leukemia
cpoc05221  Acute myeloid leukemia
cpoc05223  Non-small cell lung cancer
cpoc05224  Breast cancer
cpoc05225  Hepatocellular carcinoma
cpoc05226  Gastric cancer
cpoc05230  Central carbon metabolism in cancer
cpoc05231  Choline metabolism in cancer
cpoc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cpoc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cpoc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100725692 (Mapk3)
   04012 ErbB signaling pathway
    100725692 (Mapk3)
   04014 Ras signaling pathway
    100725692 (Mapk3)
   04015 Rap1 signaling pathway
    100725692 (Mapk3)
   04350 TGF-beta signaling pathway
    100725692 (Mapk3)
   04370 VEGF signaling pathway
    100725692 (Mapk3)
   04371 Apelin signaling pathway
    100725692 (Mapk3)
   04668 TNF signaling pathway
    100725692 (Mapk3)
   04066 HIF-1 signaling pathway
    100725692 (Mapk3)
   04068 FoxO signaling pathway
    100725692 (Mapk3)
   04072 Phospholipase D signaling pathway
    100725692 (Mapk3)
   04071 Sphingolipid signaling pathway
    100725692 (Mapk3)
   04024 cAMP signaling pathway
    100725692 (Mapk3)
   04022 cGMP-PKG signaling pathway
    100725692 (Mapk3)
   04151 PI3K-Akt signaling pathway
    100725692 (Mapk3)
   04150 mTOR signaling pathway
    100725692 (Mapk3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100725692 (Mapk3)
   04148 Efferocytosis
    100725692 (Mapk3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100725692 (Mapk3)
   04210 Apoptosis
    100725692 (Mapk3)
   04218 Cellular senescence
    100725692 (Mapk3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100725692 (Mapk3)
   04520 Adherens junction
    100725692 (Mapk3)
   04540 Gap junction
    100725692 (Mapk3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100725692 (Mapk3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100725692 (Mapk3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100725692 (Mapk3)
   04613 Neutrophil extracellular trap formation
    100725692 (Mapk3)
   04620 Toll-like receptor signaling pathway
    100725692 (Mapk3)
   04621 NOD-like receptor signaling pathway
    100725692 (Mapk3)
   04625 C-type lectin receptor signaling pathway
    100725692 (Mapk3)
   04650 Natural killer cell mediated cytotoxicity
    100725692 (Mapk3)
   04660 T cell receptor signaling pathway
    100725692 (Mapk3)
   04658 Th1 and Th2 cell differentiation
    100725692 (Mapk3)
   04659 Th17 cell differentiation
    100725692 (Mapk3)
   04657 IL-17 signaling pathway
    100725692 (Mapk3)
   04662 B cell receptor signaling pathway
    100725692 (Mapk3)
   04664 Fc epsilon RI signaling pathway
    100725692 (Mapk3)
   04666 Fc gamma R-mediated phagocytosis
    100725692 (Mapk3)
   04062 Chemokine signaling pathway
    100725692 (Mapk3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100725692 (Mapk3)
   04929 GnRH secretion
    100725692 (Mapk3)
   04912 GnRH signaling pathway
    100725692 (Mapk3)
   04915 Estrogen signaling pathway
    100725692 (Mapk3)
   04914 Progesterone-mediated oocyte maturation
    100725692 (Mapk3)
   04917 Prolactin signaling pathway
    100725692 (Mapk3)
   04921 Oxytocin signaling pathway
    100725692 (Mapk3)
   04926 Relaxin signaling pathway
    100725692 (Mapk3)
   04935 Growth hormone synthesis, secretion and action
    100725692 (Mapk3)
   04919 Thyroid hormone signaling pathway
    100725692 (Mapk3)
   04928 Parathyroid hormone synthesis, secretion and action
    100725692 (Mapk3)
   04916 Melanogenesis
    100725692 (Mapk3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100725692 (Mapk3)
   04270 Vascular smooth muscle contraction
    100725692 (Mapk3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100725692 (Mapk3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100725692 (Mapk3)
   04725 Cholinergic synapse
    100725692 (Mapk3)
   04726 Serotonergic synapse
    100725692 (Mapk3)
   04720 Long-term potentiation
    100725692 (Mapk3)
   04730 Long-term depression
    100725692 (Mapk3)
   04723 Retrograde endocannabinoid signaling
    100725692 (Mapk3)
   04722 Neurotrophin signaling pathway
    100725692 (Mapk3)
  09158 Development and regeneration
   04360 Axon guidance
    100725692 (Mapk3)
   04380 Osteoclast differentiation
    100725692 (Mapk3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100725692 (Mapk3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100725692 (Mapk3)
   05206 MicroRNAs in cancer
    100725692 (Mapk3)
   05205 Proteoglycans in cancer
    100725692 (Mapk3)
   05207 Chemical carcinogenesis - receptor activation
    100725692 (Mapk3)
   05208 Chemical carcinogenesis - reactive oxygen species
    100725692 (Mapk3)
   05203 Viral carcinogenesis
    100725692 (Mapk3)
   05230 Central carbon metabolism in cancer
    100725692 (Mapk3)
   05231 Choline metabolism in cancer
    100725692 (Mapk3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100725692 (Mapk3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100725692 (Mapk3)
   05212 Pancreatic cancer
    100725692 (Mapk3)
   05225 Hepatocellular carcinoma
    100725692 (Mapk3)
   05226 Gastric cancer
    100725692 (Mapk3)
   05214 Glioma
    100725692 (Mapk3)
   05216 Thyroid cancer
    100725692 (Mapk3)
   05221 Acute myeloid leukemia
    100725692 (Mapk3)
   05220 Chronic myeloid leukemia
    100725692 (Mapk3)
   05218 Melanoma
    100725692 (Mapk3)
   05211 Renal cell carcinoma
    100725692 (Mapk3)
   05219 Bladder cancer
    100725692 (Mapk3)
   05215 Prostate cancer
    100725692 (Mapk3)
   05213 Endometrial cancer
    100725692 (Mapk3)
   05224 Breast cancer
    100725692 (Mapk3)
   05223 Non-small cell lung cancer
    100725692 (Mapk3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100725692 (Mapk3)
   05170 Human immunodeficiency virus 1 infection
    100725692 (Mapk3)
   05161 Hepatitis B
    100725692 (Mapk3)
   05160 Hepatitis C
    100725692 (Mapk3)
   05171 Coronavirus disease - COVID-19
    100725692 (Mapk3)
   05164 Influenza A
    100725692 (Mapk3)
   05163 Human cytomegalovirus infection
    100725692 (Mapk3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100725692 (Mapk3)
   05165 Human papillomavirus infection
    100725692 (Mapk3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100725692 (Mapk3)
   05135 Yersinia infection
    100725692 (Mapk3)
   05133 Pertussis
    100725692 (Mapk3)
   05152 Tuberculosis
    100725692 (Mapk3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100725692 (Mapk3)
   05140 Leishmaniasis
    100725692 (Mapk3)
   05142 Chagas disease
    100725692 (Mapk3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100725692 (Mapk3)
   05020 Prion disease
    100725692 (Mapk3)
   05022 Pathways of neurodegeneration - multiple diseases
    100725692 (Mapk3)
  09165 Substance dependence
   05034 Alcoholism
    100725692 (Mapk3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100725692 (Mapk3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100725692 (Mapk3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100725692 (Mapk3)
   04934 Cushing syndrome
    100725692 (Mapk3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100725692 (Mapk3)
   01524 Platinum drug resistance
    100725692 (Mapk3)
   01522 Endocrine resistance
    100725692 (Mapk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpoc01001]
    100725692 (Mapk3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cpoc03036]
    100725692 (Mapk3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpoc04147]
    100725692 (Mapk3)
Enzymes [BR:cpoc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100725692 (Mapk3)
Protein kinases [BR:cpoc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100725692 (Mapk3)
Chromosome and associated proteins [BR:cpoc03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100725692 (Mapk3)
Exosome [BR:cpoc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100725692 (Mapk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 100725692
NCBI-ProteinID: XP_003478275
Ensembl: ENSCPOG00000003253
UniProt: A0A286XN62
LinkDB
Position
Unknown
AA seq 437 aa
MKFNEAGPGSNRREGVTVSLSARRVSDRLRRAGPAQPRTWHQADQPGALRVTGGRGGVEM
AAAAQGGGGGEPRGAGGVGPGVSGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDH
IRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIVQ
DLMETDLYKLLRSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKI
CDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNR
PIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPRSDSK
ALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERLKE
LIFQETARFQPGASDAP
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgaagttcaatgaagcaggccctggatccaatcgccgagagggcgtgaccgtctccctg
agcgcccgccgagtctctgacagactgcggcgcgcgggtccggcgcagcccaggacctgg
caccaagccgaccagccgggcgcgctgcgggtcacgggagggcggggaggagtggagatg
gcggcggctgcacaggggggcgggggcggggagccccggggagctggtggggtgggcccg
ggggtctcgggggaagtggaggtcgtgaaggggcagccgttcgacgtgggcccgcgctac
acgcagctgcagtacatcggcgagggtgcctacggcatggtcagctcagcttatgaccac
attcgaaagactcgggtggccataaagaagatcagcccctttgagcatcagacctactgt
cagcgcactctacgggagatccagatcttgctgcggttccgccatgagaatgtcataggc
atccgagatattcttcgggcacctaccctggaagccatgagagatgtctacattgtgcag
gacctgatggagacggacctgtacaagttgctcagaagccagcaattgagcaatgaccac
atctgctacttcctctaccagatccttcggggcctcaagtatattcactcggccaatgtg
ctccaccgggatttaaagccttccaacctgctcatcaacaccacctgcgaccttaagatc
tgtgatttcggcctggcccggattgctgatcctgagcatgaccatactggctttctaact
gagtatgtggccacacgctggtaccgggctccagagatcatgcttaactctaagggctac
accaagtccatcgacatctggtctgtgggctgcatcctggctgagatgctctccaaccgg
cccatcttccctggaaagcactacctggaccagctcaaccacattctgggtatcctgggc
tccccatcccaggaggacctgaattgtatcattaacatgaaggcccgaaactacctacag
tctctgccctctaagactaaggtggcctgggccaagctttttccgaggtcagactccaaa
gctcttgacctcctggaccggatgttaactttcaatcccaacaagcggatcacagtggag
gaggcgctggctcacccctacctggagcagtactatgaccccacagatgagccagtggct
gaagagcccttcacttttgacatggagctggatgatctacccaaggagcggctgaaggag
cttatcttccaagagacagcccgctttcagccaggagcatcagatgccccctaa

DBGET integrated database retrieval system