Cavia porcellus (domestic guinea pig): 100726990 Help Entry 100726990         CDS       T07777                                  Name (RefSeq) interferon alpha-17-like   KO K05414   interferon alpha Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04060   Cytokine-cytokine receptor interaction cpoc04151   PI3K-Akt signaling pathway cpoc04217   Necroptosis cpoc04620   Toll-like receptor signaling pathway cpoc04621   NOD-like receptor signaling pathway cpoc04622   RIG-I-like receptor signaling pathway cpoc04623   Cytosolic DNA-sensing pathway cpoc04630   JAK-STAT signaling pathway cpoc04650   Natural killer cell mediated cytotoxicity cpoc04936   Alcoholic liver disease cpoc05152   Tuberculosis cpoc05160   Hepatitis C cpoc05161   Hepatitis B cpoc05162   Measles cpoc05163   Human cytomegalovirus infection cpoc05164   Influenza A cpoc05165   Human papillomavirus infection cpoc05167   Kaposi sarcoma-associated herpesvirus infection cpoc05168   Herpes simplex virus 1 infection cpoc05169   Epstein-Barr virus infection cpoc05170   Human immunodeficiency virus 1 infection cpoc05171   Coronavirus disease - COVID-19 cpoc05200   Pathways in cancer cpoc05320   Autoimmune thyroid disease cpoc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100726990    04151 PI3K-Akt signaling pathway     100726990   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100726990  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100726990  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100726990    04621 NOD-like receptor signaling pathway     100726990    04622 RIG-I-like receptor signaling pathway     100726990    04623 Cytosolic DNA-sensing pathway     100726990    04650 Natural killer cell mediated cytotoxicity     100726990  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100726990   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100726990    05161 Hepatitis B     100726990    05160 Hepatitis C     100726990    05171 Coronavirus disease - COVID-19     100726990    05164 Influenza A     100726990    05162 Measles     100726990    05168 Herpes simplex virus 1 infection     100726990    05163 Human cytomegalovirus infection     100726990    05167 Kaposi sarcoma-associated herpesvirus infection     100726990    05169 Epstein-Barr virus infection     100726990    05165 Human papillomavirus infection     100726990   09171 Infectious disease: bacterial    05152 Tuberculosis     100726990   09163 Immune disease    05320 Autoimmune thyroid disease     100726990   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100726990   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100726990  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cpoc04052]     100726990 Cytokines and neuropeptides [BR:cpoc04052]  Cytokines   Interferons    100726990 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon TMIE Motif Other DBs NCBI-GeneID:  100726990 NCBI-ProteinID:  XP_003478898 UniProt:  A0A7R8C358 LinkDB All DBs Position Unknown AA seq 186 aa AA seqDB search MAWPLTGLMALTVLTIMASCSLDCTLPRTYMQWNTTALRPQDKMNRTIPFSCLKHRQDFG LALLDFDGKQVQKTQALSVLHEMTTQSLNFLSQNSHAAWNQSVLRTFCDALRDQMNDLKA CLTKETGLEDPSLLHEDSRNAVKKYFRGITDYLKEKSYSPCAWEVVGAEFFRSFSSSEEL WRKMQD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atggcctggccattgactggattgatggccctgactgtgctgaccatcatggcatcctgc tctctggattgcaccctgcctcggacctatatgcagtggaacaccacagccttgcgtcct caagacaaaatgaacagaaccatccctttctcctgcctgaagcacagacaggactttggc ttggccctgttggactttgatggcaagcaggtccagaaaactcaggctctctctgtcctt catgagatgaccacgcagtccctaaacttcttatcacagaactcacatgctgcctggaac cagagtgtccttagaaccttctgcgatgccctccgtgatcagatgaatgacctgaaggcc tgcctgacgaaggagacagggctggaagacccttccctgttgcatgaggactccagaaat gctgtgaagaaatacttccgagggatcactgactacctgaaggagaagagctacagccct tgtgcctgggaggtggtcggagcagaattcttcagatccttctcttcctcagaagaactg tggagaaagatgcaggactga

DBGET integrated database retrieval system