Cavia porcellus (domestic guinea pig): 100727057 Help Entry 100727057         CDS       T07777                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04613   Neutrophil extracellular trap formation cpoc05034   Alcoholism cpoc05202   Transcriptional misregulation in cancer cpoc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cpoc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100727057  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100727057   09163 Immune disease    05322 Systemic lupus erythematosus     100727057   09165 Substance dependence    05034 Alcoholism     100727057  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cpoc03036]     100727057   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cpoc04147]     100727057 Chromosome and associated proteins [BR:cpoc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100727057 Exosome [BR:cpoc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100727057 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-S CENP-T_C TFIID-31kDa Motif Other DBs NCBI-GeneID:  100727057 NCBI-ProteinID:  XP_003477289 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MARTKQTAHKSTGGKVRRKQLATKATRKSAPSTGGVKKPHRYRPGTEALREIRRFQKSTE LLICETSQDFKTDLRFQSAAIGALQEASEAYLVGLIEDTNLCAIHAKRVTIMPKDIQLAR HIRGEHA NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atggctcgtaccaagcagactgcccacaaatccactggtggtaaagtgcgcaggaaacaa ctggctacaaaagccacacgtaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctgggaccgaggcacttcgtgaaattaggcgttttcagaagtccactgaa cttctgatttgcgaaacttctcaggacttcaaaacagatctgcgttttcagagtgcagct attggtgctttgcaggaggcaagtgaggcctatctggttggcctgattgaagacaccaac ctgtgtgccatccatgccaaacgtgtcacaattatgccaaaagacatccagctagcacgc cacattcgtggagaacatgcttaa

DBGET integrated database retrieval system