Cavia porcellus (domestic guinea pig): 100727090 Help Entry 100727090         CDS       T07777                                  Symbol Rab2a Name (RefSeq) ras-related protein Rab-2A   KO K07877   Ras-related protein Rab-2A Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04152   AMPK signaling pathway Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     100727090 (Rab2a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cpoc04131]     100727090 (Rab2a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cpoc04147]     100727090 (Rab2a)    04031 GTP-binding proteins [BR:cpoc04031]     100727090 (Rab2a) Membrane trafficking [BR:cpoc04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Rab GTPases     100727090 (Rab2a) Exosome [BR:cpoc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100727090 (Rab2a)   Exosomal proteins of other body fluids (saliva and urine)    100727090 (Rab2a)   Exosomal proteins of colorectal cancer cells    100727090 (Rab2a) GTP-binding proteins [BR:cpoc04031]  Small (monomeric) G-proteins   Rab Family    Rab2/4/14 [OT]     100727090 (Rab2a) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA AAA_chap_N Motif Other DBs NCBI-GeneID:  100727090 NCBI-ProteinID:  XP_003464460 Ensembl:  ENSCPOG00000035393 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQ HSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKE IYEKIQEGVFDINNEANGIKIGPQHAATNATHAGSQGGQQAGGGCC NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgataactattgatggaaaacagataaaactccaaatctgggatactgcagggcaagag tccttccgttctattacaaggtcgtactacagaggcgctgcgggggctttgctagtgtat gatattacaaggagagatacattcaaccacttgacaacctggttagaggacgcccgccag cattccaattccaacatggtcattatgcttattggaaataaaagtgacttagaatctaga agagaagttaaaaaagaagaaggtgaagcttttgcacgggaacatggcctcatcttcatg gaaacttctgctaagactgcttccaatgtagaagaggcatttattaatacagcaaaagaa atttatgaaaaaattcaagaaggagtctttgacattaataacgaggcaaatggcattaag attggcccccagcacgctgctactaacgcgacacatgccggcagtcagggaggacagcag gctggaggaggctgctgctga

DBGET integrated database retrieval system