KEGG   Cavia porcellus (domestic guinea pig): 100727219
Entry
100727219         CDS       T07777                                 
Symbol
Rac1
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1 isoform X2
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
cpoc  Cavia porcellus (domestic guinea pig)
Pathway
cpoc04010  MAPK signaling pathway
cpoc04014  Ras signaling pathway
cpoc04015  Rap1 signaling pathway
cpoc04024  cAMP signaling pathway
cpoc04062  Chemokine signaling pathway
cpoc04071  Sphingolipid signaling pathway
cpoc04145  Phagosome
cpoc04148  Efferocytosis
cpoc04151  PI3K-Akt signaling pathway
cpoc04310  Wnt signaling pathway
cpoc04360  Axon guidance
cpoc04370  VEGF signaling pathway
cpoc04380  Osteoclast differentiation
cpoc04510  Focal adhesion
cpoc04517  IgSF CAM signaling
cpoc04518  Integrin signaling
cpoc04520  Adherens junction
cpoc04530  Tight junction
cpoc04613  Neutrophil extracellular trap formation
cpoc04620  Toll-like receptor signaling pathway
cpoc04650  Natural killer cell mediated cytotoxicity
cpoc04662  B cell receptor signaling pathway
cpoc04664  Fc epsilon RI signaling pathway
cpoc04666  Fc gamma R-mediated phagocytosis
cpoc04670  Leukocyte transendothelial migration
cpoc04722  Neurotrophin signaling pathway
cpoc04810  Regulation of actin cytoskeleton
cpoc04932  Non-alcoholic fatty liver disease
cpoc04933  AGE-RAGE signaling pathway in diabetic complications
cpoc04972  Pancreatic secretion
cpoc05014  Amyotrophic lateral sclerosis
cpoc05020  Prion disease
cpoc05022  Pathways of neurodegeneration - multiple diseases
cpoc05100  Bacterial invasion of epithelial cells
cpoc05132  Salmonella infection
cpoc05135  Yersinia infection
cpoc05163  Human cytomegalovirus infection
cpoc05167  Kaposi sarcoma-associated herpesvirus infection
cpoc05169  Epstein-Barr virus infection
cpoc05170  Human immunodeficiency virus 1 infection
cpoc05200  Pathways in cancer
cpoc05203  Viral carcinogenesis
cpoc05205  Proteoglycans in cancer
cpoc05208  Chemical carcinogenesis - reactive oxygen species
cpoc05210  Colorectal cancer
cpoc05211  Renal cell carcinoma
cpoc05212  Pancreatic cancer
cpoc05231  Choline metabolism in cancer
cpoc05415  Diabetic cardiomyopathy
cpoc05416  Viral myocarditis
cpoc05417  Lipid and atherosclerosis
cpoc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cpoc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100727219 (Rac1)
   04014 Ras signaling pathway
    100727219 (Rac1)
   04015 Rap1 signaling pathway
    100727219 (Rac1)
   04310 Wnt signaling pathway
    100727219 (Rac1)
   04370 VEGF signaling pathway
    100727219 (Rac1)
   04071 Sphingolipid signaling pathway
    100727219 (Rac1)
   04024 cAMP signaling pathway
    100727219 (Rac1)
   04151 PI3K-Akt signaling pathway
    100727219 (Rac1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    100727219 (Rac1)
   04518 Integrin signaling
    100727219 (Rac1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100727219 (Rac1)
   04148 Efferocytosis
    100727219 (Rac1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100727219 (Rac1)
   04520 Adherens junction
    100727219 (Rac1)
   04530 Tight junction
    100727219 (Rac1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100727219 (Rac1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100727219 (Rac1)
   04620 Toll-like receptor signaling pathway
    100727219 (Rac1)
   04650 Natural killer cell mediated cytotoxicity
    100727219 (Rac1)
   04662 B cell receptor signaling pathway
    100727219 (Rac1)
   04664 Fc epsilon RI signaling pathway
    100727219 (Rac1)
   04666 Fc gamma R-mediated phagocytosis
    100727219 (Rac1)
   04670 Leukocyte transendothelial migration
    100727219 (Rac1)
   04062 Chemokine signaling pathway
    100727219 (Rac1)
  09154 Digestive system
   04972 Pancreatic secretion
    100727219 (Rac1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100727219 (Rac1)
  09158 Development and regeneration
   04360 Axon guidance
    100727219 (Rac1)
   04380 Osteoclast differentiation
    100727219 (Rac1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100727219 (Rac1)
   05205 Proteoglycans in cancer
    100727219 (Rac1)
   05208 Chemical carcinogenesis - reactive oxygen species
    100727219 (Rac1)
   05203 Viral carcinogenesis
    100727219 (Rac1)
   05231 Choline metabolism in cancer
    100727219 (Rac1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100727219 (Rac1)
   05212 Pancreatic cancer
    100727219 (Rac1)
   05211 Renal cell carcinoma
    100727219 (Rac1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100727219 (Rac1)
   05163 Human cytomegalovirus infection
    100727219 (Rac1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100727219 (Rac1)
   05169 Epstein-Barr virus infection
    100727219 (Rac1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100727219 (Rac1)
   05135 Yersinia infection
    100727219 (Rac1)
   05100 Bacterial invasion of epithelial cells
    100727219 (Rac1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100727219 (Rac1)
   05020 Prion disease
    100727219 (Rac1)
   05022 Pathways of neurodegeneration - multiple diseases
    100727219 (Rac1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100727219 (Rac1)
   05418 Fluid shear stress and atherosclerosis
    100727219 (Rac1)
   05415 Diabetic cardiomyopathy
    100727219 (Rac1)
   05416 Viral myocarditis
    100727219 (Rac1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100727219 (Rac1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100727219 (Rac1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cpoc04131]
    100727219 (Rac1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpoc04147]
    100727219 (Rac1)
   04031 GTP-binding proteins [BR:cpoc04031]
    100727219 (Rac1)
Membrane trafficking [BR:cpoc04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    100727219 (Rac1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    100727219 (Rac1)
  Macropinocytosis
   Ras GTPases
    100727219 (Rac1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    100727219 (Rac1)
Exosome [BR:cpoc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100727219 (Rac1)
  Exosomal proteins of other body fluids (saliva and urine)
   100727219 (Rac1)
  Exosomal proteins of colorectal cancer cells
   100727219 (Rac1)
  Exosomal proteins of bladder cancer cells
   100727219 (Rac1)
GTP-binding proteins [BR:cpoc04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100727219 (Rac1)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Other DBs
NCBI-GeneID: 100727219
NCBI-ProteinID: XP_003470082
Ensembl: ENSCPOG00000008590
UniProt: H0VCP4
LinkDB
Position
Unknown
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccattaagtgtgtggtggtgggagacggagctgtaggtaaaacttgcctactg
atcagttacacaaccaatgcatttcccggagaatatatccctactgtctttgacaactat
tctgccaatgttatggtagatggaaaaccagtgaatctgggcttatgggatacagctgga
caagaagattatgacagattacgtcccctctcctatccgcaaacagatgtgttcttaatt
tgcttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatccagaa
gtgcgacaccattgtcccaacactcccattatccttgtgggaacaaaacttgatcttagg
gatgataaagacacgatcgagaaactgaaggagaagaagctgactcccatcacctatcca
cagggtttggccatggccaaggagatcggtgctgtaaaatatctggagtgctcggctctc
actcaacgaggcctcaagacagtgtttgatgaagctatccgagcagttctctgcccacct
cctgtcaagaagaggaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system