Cavia porcellus (domestic guinea pig): 100727780 Help Entry 100727780         CDS       T07777                                  Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04978   Mineral absorption Brite KEGG Orthology (KO) [BR:cpoc00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     100727780  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cpoc03019]     100727780    03029 Mitochondrial biogenesis [BR:cpoc03029]     100727780 Messenger RNA biogenesis [BR:cpoc03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100727780 Mitochondrial biogenesis [BR:cpoc03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     100727780 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  100727780 NCBI-ProteinID:  XP_003472132 Ensembl:  ENSCPOG00000030472 UniProt:  A0A286XZF7 LinkDB All DBs Position Unknown AA seq 61 aa AA seqDB search MDPNCSCAAGGSCTCAGSCTCKECRCSSCKKSCCACCPVGCAKCAQGCVCKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgttcctgcgctgccggcggctcctgcacctgcgccggctcctgcact tgcaaagagtgcagatgctcctcctgcaagaagagctgctgcgcctgctgcccggtaggc tgtgccaaatgcgctcagggctgcgtctgcaaaggggcgtccgataagtgcagctgctgc gcctaa

DBGET integrated database retrieval system