Cavia porcellus (domestic guinea pig): 100728398 Help Entry 100728398         CDS       T07777                                  Symbol Fgf21 Name (RefSeq) fibroblast growth factor 21   KO K22429   fibroblast growth factor 21 Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04010   MAPK signaling pathway cpoc04014   Ras signaling pathway cpoc04015   Rap1 signaling pathway cpoc04020   Calcium signaling pathway cpoc04151   PI3K-Akt signaling pathway cpoc04714   Thermogenesis cpoc04810   Regulation of actin cytoskeleton cpoc05200   Pathways in cancer cpoc05218   Melanoma cpoc05224   Breast cancer cpoc05226   Gastric cancer Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100728398 (Fgf21)    04014 Ras signaling pathway     100728398 (Fgf21)    04015 Rap1 signaling pathway     100728398 (Fgf21)    04020 Calcium signaling pathway     100728398 (Fgf21)    04151 PI3K-Akt signaling pathway     100728398 (Fgf21)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100728398 (Fgf21)  09150 Organismal Systems   09159 Environmental adaptation    04714 Thermogenesis     100728398 (Fgf21)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100728398 (Fgf21)   09162 Cancer: specific types    05226 Gastric cancer     100728398 (Fgf21)    05218 Melanoma     100728398 (Fgf21)    05224 Breast cancer     100728398 (Fgf21)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cpoc04052]     100728398 (Fgf21)    00536 Glycosaminoglycan binding proteins [BR:cpoc00536]     100728398 (Fgf21) Cytokines and neuropeptides [BR:cpoc04052]  Cytokines   Growth factors (RTK binding)    100728398 (Fgf21) Glycosaminoglycan binding proteins [BR:cpoc00536]  Heparan sulfate / Heparin   Growth factors/receptors    100728398 (Fgf21) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  100728398 NCBI-ProteinID:  XP_003465485 Ensembl:  ENSCPOG00000000270 UniProt:  H0UTJ6 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MTRAPLMDWARTECERPRLWVSMLAILLVGACQAHPIPDSSPLLQFGGQVRQRYLYTDDA QDTEVHLEIRADGSVRGIAHRSPESLLELKALKPGVIQILGIRTSRFLCQRPDGSLYGSL HFDPEACSFRELLLADGYNVYKSEAHGLPLHLLRGDSLSQEPAPPGPARFLPLPGLPATP PEPPRMLPPGPPDVGSSDPLSMVGPLWDRSPSYTS NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgacgcgtgcaccattgatggactgggcccggactgagtgtgagcgcccaaggctgtgg gtctccatgctggccatccttctggtgggagcctgccaggcacaccctatccctgactcc agccccctcctccagtttgggggccaggtccggcagcggtacctctacacagatgatgct caggacactgaagtgcacctggagatcagggccgatggctcagtacggggcattgcccac aggagccctgaaagtctcctggagctgaaagccttgaagccaggagtcattcagatcttg ggaatcaggacttccaggttcctgtgccagaggcccgatgggagtctgtatggatcactc cactttgatcctgaggcctgcagcttccgggagctgctgcttgctgatggctacaatgtc tacaagtctgaagcccacggcctccctctgcacctgctgcgcggtgactctctatcgcag gaaccagcacccccaggaccagcccgatttctgccactaccaggcctgcccgcaacaccc ccggagccacccaggatgctgcccccagggcccccagatgtgggctcctcggaccctttg agcatggtggggcctttatgggaccgaagccccagctatacttcctga

DBGET integrated database retrieval system