KEGG   Cavia porcellus (domestic guinea pig): 100728625
Entry
100728625         CDS       T07777                                 
Name
(RefSeq) calmodulin-4
  KO
K02183  calmodulin
Organism
cpoc  Cavia porcellus (domestic guinea pig)
Pathway
cpoc04014  Ras signaling pathway
cpoc04015  Rap1 signaling pathway
cpoc04020  Calcium signaling pathway
cpoc04022  cGMP-PKG signaling pathway
cpoc04024  cAMP signaling pathway
cpoc04070  Phosphatidylinositol signaling system
cpoc04114  Oocyte meiosis
cpoc04218  Cellular senescence
cpoc04261  Adrenergic signaling in cardiomyocytes
cpoc04270  Vascular smooth muscle contraction
cpoc04371  Apelin signaling pathway
cpoc04625  C-type lectin receptor signaling pathway
cpoc04713  Circadian entrainment
cpoc04720  Long-term potentiation
cpoc04722  Neurotrophin signaling pathway
cpoc04728  Dopaminergic synapse
cpoc04740  Olfactory transduction
cpoc04744  Phototransduction
cpoc04750  Inflammatory mediator regulation of TRP channels
cpoc04910  Insulin signaling pathway
cpoc04912  GnRH signaling pathway
cpoc04915  Estrogen signaling pathway
cpoc04916  Melanogenesis
cpoc04921  Oxytocin signaling pathway
cpoc04922  Glucagon signaling pathway
cpoc04924  Renin secretion
cpoc04925  Aldosterone synthesis and secretion
cpoc04970  Salivary secretion
cpoc04971  Gastric acid secretion
cpoc05010  Alzheimer disease
cpoc05012  Parkinson disease
cpoc05022  Pathways of neurodegeneration - multiple diseases
cpoc05031  Amphetamine addiction
cpoc05034  Alcoholism
cpoc05133  Pertussis
cpoc05152  Tuberculosis
cpoc05163  Human cytomegalovirus infection
cpoc05167  Kaposi sarcoma-associated herpesvirus infection
cpoc05170  Human immunodeficiency virus 1 infection
cpoc05200  Pathways in cancer
cpoc05214  Glioma
cpoc05417  Lipid and atherosclerosis
cpoc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cpoc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100728625
   04015 Rap1 signaling pathway
    100728625
   04371 Apelin signaling pathway
    100728625
   04020 Calcium signaling pathway
    100728625
   04070 Phosphatidylinositol signaling system
    100728625
   04024 cAMP signaling pathway
    100728625
   04022 cGMP-PKG signaling pathway
    100728625
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100728625
   04218 Cellular senescence
    100728625
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100728625
  09152 Endocrine system
   04910 Insulin signaling pathway
    100728625
   04922 Glucagon signaling pathway
    100728625
   04912 GnRH signaling pathway
    100728625
   04915 Estrogen signaling pathway
    100728625
   04921 Oxytocin signaling pathway
    100728625
   04916 Melanogenesis
    100728625
   04924 Renin secretion
    100728625
   04925 Aldosterone synthesis and secretion
    100728625
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100728625
   04270 Vascular smooth muscle contraction
    100728625
  09154 Digestive system
   04970 Salivary secretion
    100728625
   04971 Gastric acid secretion
    100728625
  09156 Nervous system
   04728 Dopaminergic synapse
    100728625
   04720 Long-term potentiation
    100728625
   04722 Neurotrophin signaling pathway
    100728625
  09157 Sensory system
   04744 Phototransduction
    100728625
   04740 Olfactory transduction
    100728625
   04750 Inflammatory mediator regulation of TRP channels
    100728625
  09159 Environmental adaptation
   04713 Circadian entrainment
    100728625
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100728625
  09162 Cancer: specific types
   05214 Glioma
    100728625
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100728625
   05163 Human cytomegalovirus infection
    100728625
   05167 Kaposi sarcoma-associated herpesvirus infection
    100728625
  09171 Infectious disease: bacterial
   05133 Pertussis
    100728625
   05152 Tuberculosis
    100728625
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100728625
   05012 Parkinson disease
    100728625
   05022 Pathways of neurodegeneration - multiple diseases
    100728625
  09165 Substance dependence
   05031 Amphetamine addiction
    100728625
   05034 Alcoholism
    100728625
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100728625
   05418 Fluid shear stress and atherosclerosis
    100728625
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cpoc01009]
    100728625
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cpoc04131]
    100728625
   03036 Chromosome and associated proteins [BR:cpoc03036]
    100728625
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpoc04147]
    100728625
Protein phosphatases and associated proteins [BR:cpoc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100728625
Membrane trafficking [BR:cpoc04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    100728625
Chromosome and associated proteins [BR:cpoc03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     100728625
Exosome [BR:cpoc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100728625
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 AIF-1 EF-hand_FSTL1 EF-hand_9 EF-hand_EFHB_C SPARC_Ca_bdg EH Dockerin_1 EF_EFCAB10_C DUF5580_M EF-hand_11 EF-hand_STIM1 SAPC2_N UPF0154 TerB Gp-FAR-1 DUF4191 DUF7952 SurA_N_3 Temptin_C DUF3008 SurA_N_2 EF-hand_SWAP70_N DUF4252 MTIP_N TMP_3 EF-hand_14 DUF8146 ExbD DUF2267 DUF892 DUF3987 Gp18_domIII_N Flagellar_rod DUF6247 RelA_AH_RIS cas_Cpf1_2nd CENP-Q
Other DBs
NCBI-GeneID: 100728625
NCBI-ProteinID: XP_003473475
LinkDB
Position
Unknown
AA seq 148 aa
MAKELSPEQKAAFKAAFDEADSNKDGKISLQELRDVVKKLGKNISDEELKQLMKAVDKDG
DGSISFEEFLEAMKKQAKALGNEEMRAAFQAFDLNGDGHISVEELKQTMTQLGQHLSQEE
LDDMIQMADVDKDGKVNYEEFMKVLSQK
NT seq 447 nt   +upstreamnt  +downstreamnt
atggccaaggaactgtctccagaacaaaaggctgcattcaaggcggcctttgatgaggct
gactcaaataaagatggcaagatcagcctgcaggagctgcgtgacgtggtaaagaagctg
ggcaagaatatctcagatgaagagctgaaacaactaatgaaggctgtggacaaggatggt
gatggtagcatcagctttgaggagttcctggaagcgatgaaaaagcaggcgaaggccctg
ggcaatgaggagatgcgggctgccttccaagcctttgatctgaatggtgatggccacatc
agtgtggaagagctcaaacagaccatgacccagctggggcagcatctttctcaggaggag
ctggatgacatgatccagatggctgatgtggacaaggatgggaaggtgaactacgaggag
ttcatgaaggtcctcagtcagaagtga

DBGET integrated database retrieval system