Cavia porcellus (domestic guinea pig): 100729712 Help Entry 100729712         CDS       T07777                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04014   Ras signaling pathway cpoc04015   Rap1 signaling pathway cpoc04020   Calcium signaling pathway cpoc04022   cGMP-PKG signaling pathway cpoc04024   cAMP signaling pathway cpoc04070   Phosphatidylinositol signaling system cpoc04114   Oocyte meiosis cpoc04218   Cellular senescence cpoc04261   Adrenergic signaling in cardiomyocytes cpoc04270   Vascular smooth muscle contraction cpoc04371   Apelin signaling pathway cpoc04625   C-type lectin receptor signaling pathway cpoc04713   Circadian entrainment cpoc04720   Long-term potentiation cpoc04722   Neurotrophin signaling pathway cpoc04728   Dopaminergic synapse cpoc04740   Olfactory transduction cpoc04744   Phototransduction cpoc04750   Inflammatory mediator regulation of TRP channels cpoc04910   Insulin signaling pathway cpoc04912   GnRH signaling pathway cpoc04915   Estrogen signaling pathway cpoc04916   Melanogenesis cpoc04921   Oxytocin signaling pathway cpoc04922   Glucagon signaling pathway cpoc04924   Renin secretion cpoc04925   Aldosterone synthesis and secretion cpoc04970   Salivary secretion cpoc04971   Gastric acid secretion cpoc05010   Alzheimer disease cpoc05012   Parkinson disease cpoc05022   Pathways of neurodegeneration - multiple diseases cpoc05031   Amphetamine addiction cpoc05034   Alcoholism cpoc05133   Pertussis cpoc05152   Tuberculosis cpoc05163   Human cytomegalovirus infection cpoc05167   Kaposi sarcoma-associated herpesvirus infection cpoc05170   Human immunodeficiency virus 1 infection cpoc05200   Pathways in cancer cpoc05214   Glioma cpoc05417   Lipid and atherosclerosis cpoc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100729712    04015 Rap1 signaling pathway     100729712    04371 Apelin signaling pathway     100729712    04020 Calcium signaling pathway     100729712    04070 Phosphatidylinositol signaling system     100729712    04024 cAMP signaling pathway     100729712    04022 cGMP-PKG signaling pathway     100729712  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     100729712    04218 Cellular senescence     100729712  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100729712   09152 Endocrine system    04910 Insulin signaling pathway     100729712    04922 Glucagon signaling pathway     100729712    04912 GnRH signaling pathway     100729712    04915 Estrogen signaling pathway     100729712    04921 Oxytocin signaling pathway     100729712    04916 Melanogenesis     100729712    04924 Renin secretion     100729712    04925 Aldosterone synthesis and secretion     100729712   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     100729712    04270 Vascular smooth muscle contraction     100729712   09154 Digestive system    04970 Salivary secretion     100729712    04971 Gastric acid secretion     100729712   09156 Nervous system    04728 Dopaminergic synapse     100729712    04720 Long-term potentiation     100729712    04722 Neurotrophin signaling pathway     100729712   09157 Sensory system    04744 Phototransduction     100729712    04740 Olfactory transduction     100729712    04750 Inflammatory mediator regulation of TRP channels     100729712   09159 Environmental adaptation    04713 Circadian entrainment     100729712  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100729712   09162 Cancer: specific types    05214 Glioma     100729712   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100729712    05163 Human cytomegalovirus infection     100729712    05167 Kaposi sarcoma-associated herpesvirus infection     100729712   09171 Infectious disease: bacterial    05133 Pertussis     100729712    05152 Tuberculosis     100729712   09164 Neurodegenerative disease    05010 Alzheimer disease     100729712    05012 Parkinson disease     100729712    05022 Pathways of neurodegeneration - multiple diseases     100729712   09165 Substance dependence    05031 Amphetamine addiction     100729712    05034 Alcoholism     100729712   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100729712    05418 Fluid shear stress and atherosclerosis     100729712  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cpoc01009]     100729712   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cpoc04131]     100729712    03036 Chromosome and associated proteins [BR:cpoc03036]     100729712   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cpoc04147]     100729712 Protein phosphatases and associated proteins [BR:cpoc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100729712 Membrane trafficking [BR:cpoc04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     100729712 Chromosome and associated proteins [BR:cpoc03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      100729712 Exosome [BR:cpoc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100729712 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 Dockerin_1 UPF0154 EFhand_Ca_insen TerB Caleosin FCaBP_EF-hand DUF5580_M DUF1103 SPEF2_C MecA_N SurA_N_3 DUF2267 Motif Other DBs NCBI-GeneID:  100729712 NCBI-ProteinID:  XP_023419120 Ensembl:  ENSCPOG00000008949 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITTKEIGTVMRSLGQNPTEAELQAMISEADADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEMIREADINGDGQVNYEEFIQMMVAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgatcagctgaccgaagaacagattgctgaattcaaggaagctttctccttattt gataaagatggcgacggcaccatcaccacaaaggaaataggaactgtcatgagatcactg ggtcaaaacccaaccgaagctgaactgcaggctatgatcagcgaagcggatgctgacggt aatggcaccattgacttcccggaatttttgactatgatggctagaaaaatgaaagacaca gatagcgaggaagaaatccgcgaggcattccgagtctttgacaaggatggaaatggttac atcagtgcagcggaactgcgtcatgtcatgacaaacttaggagaaaaactaacagacgaa gaagtagatgaaatgatcagagaagcagatattaatggagatggacaagtcaactatgaa gaattcatacagatgatggttgcgaaatga

DBGET integrated database retrieval system