Cavia porcellus (domestic guinea pig): 100730495 Help Entry 100730495         CDS       T07777                                  Symbol Bcl2l1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc01521   EGFR tyrosine kinase inhibitor resistance cpoc01524   Platinum drug resistance cpoc04014   Ras signaling pathway cpoc04064   NF-kappa B signaling pathway cpoc04115   p53 signaling pathway cpoc04137   Mitophagy - animal cpoc04140   Autophagy - animal cpoc04151   PI3K-Akt signaling pathway cpoc04210   Apoptosis cpoc04215   Apoptosis - multiple species cpoc04621   NOD-like receptor signaling pathway cpoc04630   JAK-STAT signaling pathway cpoc05012   Parkinson disease cpoc05014   Amyotrophic lateral sclerosis cpoc05022   Pathways of neurodegeneration - multiple diseases cpoc05145   Toxoplasmosis cpoc05162   Measles cpoc05166   Human T-cell leukemia virus 1 infection cpoc05168   Herpes simplex virus 1 infection cpoc05170   Human immunodeficiency virus 1 infection cpoc05200   Pathways in cancer cpoc05202   Transcriptional misregulation in cancer cpoc05212   Pancreatic cancer cpoc05220   Chronic myeloid leukemia cpoc05222   Small cell lung cancer cpoc05225   Hepatocellular carcinoma cpoc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100730495 (Bcl2l1)    04630 JAK-STAT signaling pathway     100730495 (Bcl2l1)    04064 NF-kappa B signaling pathway     100730495 (Bcl2l1)    04151 PI3K-Akt signaling pathway     100730495 (Bcl2l1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100730495 (Bcl2l1)    04137 Mitophagy - animal     100730495 (Bcl2l1)   09143 Cell growth and death    04210 Apoptosis     100730495 (Bcl2l1)    04215 Apoptosis - multiple species     100730495 (Bcl2l1)    04115 p53 signaling pathway     100730495 (Bcl2l1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100730495 (Bcl2l1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100730495 (Bcl2l1)    05202 Transcriptional misregulation in cancer     100730495 (Bcl2l1)   09162 Cancer: specific types    05212 Pancreatic cancer     100730495 (Bcl2l1)    05225 Hepatocellular carcinoma     100730495 (Bcl2l1)    05220 Chronic myeloid leukemia     100730495 (Bcl2l1)    05222 Small cell lung cancer     100730495 (Bcl2l1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100730495 (Bcl2l1)    05170 Human immunodeficiency virus 1 infection     100730495 (Bcl2l1)    05162 Measles     100730495 (Bcl2l1)    05168 Herpes simplex virus 1 infection     100730495 (Bcl2l1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100730495 (Bcl2l1)   09164 Neurodegenerative disease    05012 Parkinson disease     100730495 (Bcl2l1)    05014 Amyotrophic lateral sclerosis     100730495 (Bcl2l1)    05022 Pathways of neurodegeneration - multiple diseases     100730495 (Bcl2l1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100730495 (Bcl2l1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100730495 (Bcl2l1)    01524 Platinum drug resistance     100730495 (Bcl2l1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cpoc01009]     100730495 (Bcl2l1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cpoc03036]     100730495 (Bcl2l1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:cpoc02000]     100730495 (Bcl2l1) Protein phosphatases and associated proteins [BR:cpoc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      100730495 (Bcl2l1) Chromosome and associated proteins [BR:cpoc03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     100730495 (Bcl2l1) Transporters [BR:cpoc02000]  Other transporters   Pores ion channels [TC:1]    100730495 (Bcl2l1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  100730495 NCBI-ProteinID:  XP_003476706 Ensembl:  ENSCPOG00000039098 UniProt:  A0A286Y5D6 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNWELVVDFLSYKLSQKGYSWSQFSDVEENRTEGPEGTESEMETPSAINGNPSWHLT DSPTVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVRRIASWMATYLNDHLEP WIQDNGGWDTFVELYGNNAAAESRKGQERFNRWLLTGVTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcaaagcaactgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacaggactgaaggcccagaaggg actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacctaact gatagtcccacggtgaatggggccactggccacagcagtagtttggatgcccgggaggtg atccccatggcagcagtgaagcaagctcttagggaggcgggcgatgagtttgaacttcgg taccggcgagcattcagcgacttaacatctcagctccacatcaccccggggacagcatat cagagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatt gtggcctttttctccttcggcggggcattgtgcgtggagagcgtagacaaggagatgcag gtattggtgaggcggatcgcaagctggatggctacttacctgaatgaccacctagaacct tggatccaggacaacggcggctgggacacttttgtggaactctacgggaacaatgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttgctgacgggcgtgactgtg gctggcgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system