Cavia porcellus (domestic guinea pig): 100730714 Help Entry 100730714         CDS       T07777                                  Symbol Rras2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04010   MAPK signaling pathway cpoc04014   Ras signaling pathway cpoc04024   cAMP signaling pathway cpoc04072   Phospholipase D signaling pathway cpoc04137   Mitophagy - animal cpoc04140   Autophagy - animal cpoc04218   Cellular senescence cpoc04371   Apelin signaling pathway cpoc04625   C-type lectin receptor signaling pathway cpoc04810   Regulation of actin cytoskeleton cpoc05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100730714 (Rras2)    04014 Ras signaling pathway     100730714 (Rras2)    04371 Apelin signaling pathway     100730714 (Rras2)    04072 Phospholipase D signaling pathway     100730714 (Rras2)    04024 cAMP signaling pathway     100730714 (Rras2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100730714 (Rras2)    04137 Mitophagy - animal     100730714 (Rras2)   09143 Cell growth and death    04218 Cellular senescence     100730714 (Rras2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100730714 (Rras2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100730714 (Rras2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100730714 (Rras2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cpoc04147]     100730714 (Rras2)    04031 GTP-binding proteins [BR:cpoc04031]     100730714 (Rras2) Exosome [BR:cpoc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100730714 (Rras2)   Exosomal proteins of bladder cancer cells    100730714 (Rras2) GTP-binding proteins [BR:cpoc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100730714 (Rras2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Arf Roc NPHI_C SLFN-g3_helicase FeThRed_B Motif Other DBs NCBI-GeneID:  100730714 NCBI-ProteinID:  XP_023419041 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQV TQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKK GCHCVIF NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgagagaacagtacatgaggaccggagaaggcttcttgttagtcttttcagtcacagac agaggcagttttgaagaaatctataagtttcaaagacagattctcagagtaaaggatcgt gatgagtttccaatgattttaattggtaacaaagcggacctggatcatcaaaggcaggtg acccaggaagagggacagcagttagcacggcaacttaaggtaacgtacatggaggcatcg gcgaagattaggatgaatgtggatcaagctttccacgagcttgttcgggttataaggaaa tttcaagagcaagaatgtcctccttcaccagaaccaacacggaaagaaaaagacaagaaa ggctgccactgtgtcattttctaa

DBGET integrated database retrieval system