Cavia porcellus (domestic guinea pig): 100733033 Help Entry 100733033         CDS       T07777                                  Name (RefSeq) histone H2B type 1   KO K11252   histone H2B Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04613   Neutrophil extracellular trap formation cpoc05034   Alcoholism cpoc05203   Viral carcinogenesis cpoc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cpoc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100733033  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100733033   09163 Immune disease    05322 Systemic lupus erythematosus     100733033   09165 Substance dependence    05034 Alcoholism     100733033  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cpoc03036]     100733033   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cpoc04147]     100733033 Chromosome and associated proteins [BR:cpoc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100733033 Exosome [BR:cpoc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100733033 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  100733033 NCBI-ProteinID:  XP_003468847 Ensembl:  ENSCPOG00000031052 UniProt:  A0A286XMB9 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccagcgaagtcggcgcctgcccccaagaagggctccaagaaagccgtcacc aaggcgcagaagaaggatggcaagaagcgcaagcgcagccgcaaggagagctactcggtc tacgtgtacaaggtgctcaagcaggtgcaccccgacacgggcatctcgtccaaggccatg ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgccggcgaggcgtcgcgc ctggcgcactacaacaagcgctccaccatcacgtcgcgggagatccagactgccgtgcgg ctgctgctgcccggggagctggccaagcacgccgtgtcggagggcaccaaggctgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system