Cavia porcellus (domestic guinea pig): 100733542 Help Entry 100733542         CDS       T07777                                  Symbol Rhoa Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04014   Ras signaling pathway cpoc04015   Rap1 signaling pathway cpoc04022   cGMP-PKG signaling pathway cpoc04024   cAMP signaling pathway cpoc04062   Chemokine signaling pathway cpoc04071   Sphingolipid signaling pathway cpoc04072   Phospholipase D signaling pathway cpoc04081   Hormone signaling cpoc04144   Endocytosis cpoc04150   mTOR signaling pathway cpoc04270   Vascular smooth muscle contraction cpoc04310   Wnt signaling pathway cpoc04350   TGF-beta signaling pathway cpoc04360   Axon guidance cpoc04510   Focal adhesion cpoc04520   Adherens junction cpoc04530   Tight junction cpoc04611   Platelet activation cpoc04621   NOD-like receptor signaling pathway cpoc04625   C-type lectin receptor signaling pathway cpoc04660   T cell receptor signaling pathway cpoc04670   Leukocyte transendothelial migration cpoc04722   Neurotrophin signaling pathway cpoc04810   Regulation of actin cytoskeleton cpoc04921   Oxytocin signaling pathway cpoc04928   Parathyroid hormone synthesis, secretion and action cpoc04972   Pancreatic secretion cpoc05100   Bacterial invasion of epithelial cells cpoc05132   Salmonella infection cpoc05133   Pertussis cpoc05135   Yersinia infection cpoc05152   Tuberculosis cpoc05163   Human cytomegalovirus infection cpoc05200   Pathways in cancer cpoc05203   Viral carcinogenesis cpoc05205   Proteoglycans in cancer cpoc05206   MicroRNAs in cancer cpoc05210   Colorectal cancer cpoc05417   Lipid and atherosclerosis cpoc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100733542 (Rhoa)    04015 Rap1 signaling pathway     100733542 (Rhoa)    04310 Wnt signaling pathway     100733542 (Rhoa)    04350 TGF-beta signaling pathway     100733542 (Rhoa)    04072 Phospholipase D signaling pathway     100733542 (Rhoa)    04071 Sphingolipid signaling pathway     100733542 (Rhoa)    04024 cAMP signaling pathway     100733542 (Rhoa)    04022 cGMP-PKG signaling pathway     100733542 (Rhoa)    04150 mTOR signaling pathway     100733542 (Rhoa)   09133 Signaling molecules and interaction    04081 Hormone signaling     100733542 (Rhoa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100733542 (Rhoa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100733542 (Rhoa)    04520 Adherens junction     100733542 (Rhoa)    04530 Tight junction     100733542 (Rhoa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100733542 (Rhoa)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100733542 (Rhoa)    04621 NOD-like receptor signaling pathway     100733542 (Rhoa)    04625 C-type lectin receptor signaling pathway     100733542 (Rhoa)    04660 T cell receptor signaling pathway     100733542 (Rhoa)    04670 Leukocyte transendothelial migration     100733542 (Rhoa)    04062 Chemokine signaling pathway     100733542 (Rhoa)   09152 Endocrine system    04921 Oxytocin signaling pathway     100733542 (Rhoa)    04928 Parathyroid hormone synthesis, secretion and action     100733542 (Rhoa)   09153 Circulatory system    04270 Vascular smooth muscle contraction     100733542 (Rhoa)   09154 Digestive system    04972 Pancreatic secretion     100733542 (Rhoa)   09156 Nervous system    04722 Neurotrophin signaling pathway     100733542 (Rhoa)   09158 Development and regeneration    04360 Axon guidance     100733542 (Rhoa)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100733542 (Rhoa)    05206 MicroRNAs in cancer     100733542 (Rhoa)    05205 Proteoglycans in cancer     100733542 (Rhoa)    05203 Viral carcinogenesis     100733542 (Rhoa)   09162 Cancer: specific types    05210 Colorectal cancer     100733542 (Rhoa)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100733542 (Rhoa)   09171 Infectious disease: bacterial    05132 Salmonella infection     100733542 (Rhoa)    05135 Yersinia infection     100733542 (Rhoa)    05133 Pertussis     100733542 (Rhoa)    05152 Tuberculosis     100733542 (Rhoa)    05100 Bacterial invasion of epithelial cells     100733542 (Rhoa)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100733542 (Rhoa)    05418 Fluid shear stress and atherosclerosis     100733542 (Rhoa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cpoc04131]     100733542 (Rhoa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cpoc04147]     100733542 (Rhoa)    04031 GTP-binding proteins [BR:cpoc04031]     100733542 (Rhoa) Membrane trafficking [BR:cpoc04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     100733542 (Rhoa) Exosome [BR:cpoc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100733542 (Rhoa)   Exosomal proteins of other body fluids (saliva and urine)    100733542 (Rhoa)   Exosomal proteins of colorectal cancer cells    100733542 (Rhoa)   Exosomal proteins of bladder cancer cells    100733542 (Rhoa) GTP-binding proteins [BR:cpoc04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     100733542 (Rhoa) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  100733542 NCBI-ProteinID:  XP_003476717 Ensembl:  ENSCPOG00000014073 UniProt:  H0VQ69 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccgaaagaaactggtaattgttggtgatggagcttgtggtaagacatgc ttgctcatagtcttcagcaaggaccagttcccagaagtatatgttcccacagtgtttgag aactatgtggcagatattgaagtggatgggaaacaggtagagttggctttgtgggacacg gctggacaggaagattatgatcgcctgaggcctctctcttacccagatactgatgttata ctcatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggacc ccagaagtgaagcatttctgtcccaacgtacccattatcctggttgggaacaagaaggat cttcggaatgatgagcacacaaggcgggagttagccaagatgaaacaggagccagtaaaa cctgaagaaggcagagatatggcaaacaggattggcgcctttggatacatggagtgttca gcaaagaccaaagatggagtgagagaagtttttgaaatggccacgagagctgctctgcaa gccaggcgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system