Cavia porcellus (domestic guinea pig): 100734132 Help Entry 100734132         CDS       T07777                                  Symbol Rab8a Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04140   Autophagy - animal cpoc04144   Endocytosis cpoc04152   AMPK signaling pathway cpoc04530   Tight junction cpoc04972   Pancreatic secretion cpoc05014   Amyotrophic lateral sclerosis cpoc05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     100734132 (Rab8a)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100734132 (Rab8a)    04140 Autophagy - animal     100734132 (Rab8a)   09144 Cellular community - eukaryotes    04530 Tight junction     100734132 (Rab8a)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     100734132 (Rab8a)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100734132 (Rab8a)    05022 Pathways of neurodegeneration - multiple diseases     100734132 (Rab8a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cpoc04131]     100734132 (Rab8a)    03036 Chromosome and associated proteins [BR:cpoc03036]     100734132 (Rab8a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cpoc04147]     100734132 (Rab8a)    04031 GTP-binding proteins [BR:cpoc04031]     100734132 (Rab8a) Membrane trafficking [BR:cpoc04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     100734132 (Rab8a)  Autophagy   Other autophagy associated proteins     100734132 (Rab8a) Chromosome and associated proteins [BR:cpoc03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     100734132 (Rab8a) Exosome [BR:cpoc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100734132 (Rab8a)   Exosomal proteins of other body fluids (saliva and urine)    100734132 (Rab8a)   Exosomal proteins of colorectal cancer cells    100734132 (Rab8a) GTP-binding proteins [BR:cpoc04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     100734132 (Rab8a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU MMR_HSR1 SRPRB DUF3963 Septin AAA_7 Motif Other DBs NCBI-GeneID:  100734132 NCBI-ProteinID:  XP_003464305 Ensembl:  ENSCPOG00000036546 UniProt:  A0A286Y274 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMVLG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSSQGVKITPDPQKRSSFFRCILL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctcatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactccacttttatctccacc ataggaattgactttaaaattaggaccatcgagctcgatggcaagaggatcaaactgcag atttgggacacagccgggcaggagcggtttcggacgatcacaacggcctactaccggggc gccatgggtatcatgctggtctatgacatcaccaacgagaagtccttcgacaacatccgg aactggatccggaacatcgaggagcatgcctctgctgacgtggagaagatggtcttgggg aacaagtgcgacgtgaatgacaagagacaagtgtccaaggagcggggcgagaagctggcc cttgactatggaatcaagttcatggagaccagcgccaaggccaacatcaacgtggagaat gcatttttcactctcgccagagatatcaaagcaaaaatggacaaaaaattggaaggcaac agcccacagggcagcagccagggggtgaagatcacgccagacccacagaagcggagttcc ttcttccgctgcatcctcctgtga

DBGET integrated database retrieval system