Cavia porcellus (domestic guinea pig): 100734432 Help Entry 100734432         CDS       T07777                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04613   Neutrophil extracellular trap formation cpoc05034   Alcoholism cpoc05203   Viral carcinogenesis cpoc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cpoc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100734432  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100734432   09163 Immune disease    05322 Systemic lupus erythematosus     100734432   09165 Substance dependence    05034 Alcoholism     100734432  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cpoc03036]     100734432 Chromosome and associated proteins [BR:cpoc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100734432 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  100734432 NCBI-ProteinID:  XP_003468852 Ensembl:  ENSCPOG00000040800 UniProt:  H0W865 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgtggcaagggaggcaaaggccttggcaagggcggtgctaagcgccaccgg aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccgccgcctggcccgc cgtggtggtgttaaacgcatctccggtctcatctatgaggagacccgcggcgtgctcaag gtcttcctggagaatgtgatccgcgacgccgtcacctacacggagcacgccaagcgcaag acggtcaccgccatggacgtggtctacgcgctcaagcgccagggacgcacgctctacggc ttcggcggttaa

DBGET integrated database retrieval system