Cavia porcellus (domestic guinea pig): 100735029 Help Entry 100735029         CDS       T07777                                  Symbol Cck Name (RefSeq) cholecystokinin   KO K05226   cholecystokinin Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04080   Neuroactive ligand-receptor interaction cpoc04081   Hormone signaling cpoc04911   Insulin secretion cpoc04972   Pancreatic secretion Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     100735029 (Cck)    04081 Hormone signaling     100735029 (Cck)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     100735029 (Cck)   09154 Digestive system    04972 Pancreatic secretion     100735029 (Cck)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cpoc04052]     100735029 (Cck) Cytokines and neuropeptides [BR:cpoc04052]  Neuropeptides   GPCR binding    100735029 (Cck) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  100735029 NCBI-ProteinID:  XP_003476910 Ensembl:  ENSCPOG00000014533 UniProt:  H0VR95 LinkDB All DBs Position Unknown AA seq 115 aa AA seqDB search MNGGLCLCVLMAVLAIGAWTQPLSPAGPLGPEILGAEDAPGRQVRTRTGAAEPRARLGAL LARYIQQARKAPSGRMAMVKSLQGLDPNHRISDRDYVGWMDFGRRSAEEEYEYPV NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgaacggtggcctgtgcctgtgcgtgctgatggcggttctagcgattggcgcctggacg cagccgctgtcgccggcgggacccctgggcccagagatcttgggcgcggaggacgcgccc gggaggcaggttcggacgaggacgggcgccgctgagcccagggcgcgcctgggcgcgctg ctcgctcggtacatccagcaggcccggaaagccccttctggccgtatggccatggtcaag agcctgcagggcctagaccccaaccacaggataagtgaccgggactacgtgggctggatg gacttcggccggcgcagcgcagaggaggagtacgagtaccctgtgtag

DBGET integrated database retrieval system