Cavia porcellus (domestic guinea pig): 100735038 Help Entry 100735038         CDS       T07777                                  Symbol Hras Name (RefSeq) GTPase HRas isoform X1   KO K02833   GTPase HRas Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc01521   EGFR tyrosine kinase inhibitor resistance cpoc01522   Endocrine resistance cpoc04010   MAPK signaling pathway cpoc04012   ErbB signaling pathway cpoc04014   Ras signaling pathway cpoc04015   Rap1 signaling pathway cpoc04062   Chemokine signaling pathway cpoc04068   FoxO signaling pathway cpoc04071   Sphingolipid signaling pathway cpoc04072   Phospholipase D signaling pathway cpoc04137   Mitophagy - animal cpoc04140   Autophagy - animal cpoc04144   Endocytosis cpoc04150   mTOR signaling pathway cpoc04151   PI3K-Akt signaling pathway cpoc04210   Apoptosis cpoc04211   Longevity regulating pathway cpoc04213   Longevity regulating pathway - multiple species cpoc04218   Cellular senescence cpoc04360   Axon guidance cpoc04370   VEGF signaling pathway cpoc04371   Apelin signaling pathway cpoc04510   Focal adhesion cpoc04540   Gap junction cpoc04550   Signaling pathways regulating pluripotency of stem cells cpoc04625   C-type lectin receptor signaling pathway cpoc04630   JAK-STAT signaling pathway cpoc04650   Natural killer cell mediated cytotoxicity cpoc04660   T cell receptor signaling pathway cpoc04662   B cell receptor signaling pathway cpoc04664   Fc epsilon RI signaling pathway cpoc04714   Thermogenesis cpoc04720   Long-term potentiation cpoc04722   Neurotrophin signaling pathway cpoc04725   Cholinergic synapse cpoc04726   Serotonergic synapse cpoc04730   Long-term depression cpoc04810   Regulation of actin cytoskeleton cpoc04910   Insulin signaling pathway cpoc04912   GnRH signaling pathway cpoc04915   Estrogen signaling pathway cpoc04916   Melanogenesis cpoc04917   Prolactin signaling pathway cpoc04919   Thyroid hormone signaling pathway cpoc04921   Oxytocin signaling pathway cpoc04926   Relaxin signaling pathway cpoc04929   GnRH secretion cpoc04933   AGE-RAGE signaling pathway in diabetic complications cpoc04935   Growth hormone synthesis, secretion and action cpoc05010   Alzheimer disease cpoc05022   Pathways of neurodegeneration - multiple diseases cpoc05034   Alcoholism cpoc05132   Salmonella infection cpoc05160   Hepatitis C cpoc05161   Hepatitis B cpoc05163   Human cytomegalovirus infection cpoc05165   Human papillomavirus infection cpoc05166   Human T-cell leukemia virus 1 infection cpoc05167   Kaposi sarcoma-associated herpesvirus infection cpoc05170   Human immunodeficiency virus 1 infection cpoc05200   Pathways in cancer cpoc05203   Viral carcinogenesis cpoc05205   Proteoglycans in cancer cpoc05206   MicroRNAs in cancer cpoc05207   Chemical carcinogenesis - receptor activation cpoc05208   Chemical carcinogenesis - reactive oxygen species cpoc05210   Colorectal cancer cpoc05211   Renal cell carcinoma cpoc05213   Endometrial cancer cpoc05214   Glioma cpoc05215   Prostate cancer cpoc05216   Thyroid cancer cpoc05218   Melanoma cpoc05219   Bladder cancer cpoc05220   Chronic myeloid leukemia cpoc05221   Acute myeloid leukemia cpoc05223   Non-small cell lung cancer cpoc05224   Breast cancer cpoc05225   Hepatocellular carcinoma cpoc05226   Gastric cancer cpoc05230   Central carbon metabolism in cancer cpoc05231   Choline metabolism in cancer cpoc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer cpoc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100735038 (Hras)    04015 Rap1 signaling pathway     100735038 (Hras)    04630 JAK-STAT signaling pathway     100735038 (Hras)    04068 FoxO signaling pathway     100735038 (Hras)    04072 Phospholipase D signaling pathway     100735038 (Hras)    04071 Sphingolipid signaling pathway     100735038 (Hras)    04151 PI3K-Akt signaling pathway     100735038 (Hras)    04150 mTOR signaling pathway     100735038 (Hras)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100735038 (Hras)    04140 Autophagy - animal     100735038 (Hras)    04137 Mitophagy - animal     100735038 (Hras)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     100735038 (Hras)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     100735038 (Hras)    04660 T cell receptor signaling pathway     100735038 (Hras)    04662 B cell receptor signaling pathway     100735038 (Hras)    04664 Fc epsilon RI signaling pathway     100735038 (Hras)    04062 Chemokine signaling pathway     100735038 (Hras)   09152 Endocrine system    04929 GnRH secretion     100735038 (Hras)    04915 Estrogen signaling pathway     100735038 (Hras)    04917 Prolactin signaling pathway     100735038 (Hras)    04921 Oxytocin signaling pathway     100735038 (Hras)    04926 Relaxin signaling pathway     100735038 (Hras)    04935 Growth hormone synthesis, secretion and action     100735038 (Hras)    04919 Thyroid hormone signaling pathway     100735038 (Hras)   09156 Nervous system    04725 Cholinergic synapse     100735038 (Hras)    04726 Serotonergic synapse     100735038 (Hras)    04720 Long-term potentiation     100735038 (Hras)    04730 Long-term depression     100735038 (Hras)    04722 Neurotrophin signaling pathway     100735038 (Hras)   09158 Development and regeneration    04360 Axon guidance     100735038 (Hras)   09149 Aging    04211 Longevity regulating pathway     100735038 (Hras)    04213 Longevity regulating pathway - multiple species     100735038 (Hras)   09159 Environmental adaptation    04714 Thermogenesis     100735038 (Hras)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100735038 (Hras)    05206 MicroRNAs in cancer     100735038 (Hras)    05205 Proteoglycans in cancer     100735038 (Hras)    05207 Chemical carcinogenesis - receptor activation     100735038 (Hras)    05208 Chemical carcinogenesis - reactive oxygen species     100735038 (Hras)    05203 Viral carcinogenesis     100735038 (Hras)    05230 Central carbon metabolism in cancer     100735038 (Hras)    05231 Choline metabolism in cancer     100735038 (Hras)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100735038 (Hras)   09162 Cancer: specific types    05210 Colorectal cancer     100735038 (Hras)    05225 Hepatocellular carcinoma     100735038 (Hras)    05226 Gastric cancer     100735038 (Hras)    05214 Glioma     100735038 (Hras)    05216 Thyroid cancer     100735038 (Hras)    05221 Acute myeloid leukemia     100735038 (Hras)    05220 Chronic myeloid leukemia     100735038 (Hras)    05218 Melanoma     100735038 (Hras)    05211 Renal cell carcinoma     100735038 (Hras)    05219 Bladder cancer     100735038 (Hras)    05215 Prostate cancer     100735038 (Hras)    05213 Endometrial cancer     100735038 (Hras)    05224 Breast cancer     100735038 (Hras)    05223 Non-small cell lung cancer     100735038 (Hras)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100735038 (Hras)    05170 Human immunodeficiency virus 1 infection     100735038 (Hras)    05161 Hepatitis B     100735038 (Hras)    05160 Hepatitis C     100735038 (Hras)    05163 Human cytomegalovirus infection     100735038 (Hras)    05167 Kaposi sarcoma-associated herpesvirus infection     100735038 (Hras)    05165 Human papillomavirus infection     100735038 (Hras)   09164 Neurodegenerative disease    05010 Alzheimer disease     100735038 (Hras)    05022 Pathways of neurodegeneration - multiple diseases     100735038 (Hras)   09165 Substance dependence    05034 Alcoholism     100735038 (Hras)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100735038 (Hras)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100735038 (Hras)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100735038 (Hras)    01522 Endocrine resistance     100735038 (Hras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cpoc04131]     100735038 (Hras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cpoc04147]     100735038 (Hras)    04031 GTP-binding proteins [BR:cpoc04031]     100735038 (Hras) Membrane trafficking [BR:cpoc04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     100735038 (Hras)  Endocytosis   Macropinocytosis    Ras GTPases     100735038 (Hras) Exosome [BR:cpoc04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    100735038 (Hras)   Exosomal proteins of colorectal cancer cells    100735038 (Hras) GTP-binding proteins [BR:cpoc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100735038 (Hras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N G-alpha ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  100735038 NCBI-ProteinID:  XP_003461336 Ensembl:  ENSCPOG00000000101 UniProt:  A0A286Y5B4 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL ATRTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMSCKCVLS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagcttgtggtggtgggtgcaggaggtgtggggaagagcgccctgact atccagctgatccagaaccattttgtggacgaatatgaccccaccatagaggattcatac cggaagcaggtggtcattgatggggagacctgtctgctggatatcttggacacagctggc caagaggagtatagtgccatgcgggaccaatacatgcgcactggggagggcttcctttgt gtgttcgccatcaacaataccaaatctttcgaggacatccatcagtacagggagcagatc aagcgggtgaaggactcagatgatgtgcccatggtgctggtgggaaacaaatgtgacctg gctacacgcaccgtggagtctcggcaggcccaagaccttgcccgcagttacggcattccc tacattgagacatcagccaagacccgccagggagtagaagacgccttctatacactagtt cgagagatccggcagcacaaactgcggaagctgaatccaccagatgagagtgggccaggg tgcatgagctgcaaatgtgtgctatcctga

DBGET integrated database retrieval system