Cavia porcellus (domestic guinea pig): 100735278 Help Entry 100735278         CDS       T07777                                  Symbol Dynlt3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04145   Phagocytosis cpoc04814   Motor proteins cpoc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cpoc00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     100735278 (Dynlt3)   09142 Cell motility    04814 Motor proteins     100735278 (Dynlt3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100735278 (Dynlt3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cpoc03037]     100735278 (Dynlt3)    04812 Cytoskeleton proteins [BR:cpoc04812]     100735278 (Dynlt3) Cilium and associated proteins [BR:cpoc03037]  Motile cilia and associated proteins   Dynein arm    100735278 (Dynlt3) Cytoskeleton proteins [BR:cpoc04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      100735278 (Dynlt3) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  100735278 NCBI-ProteinID:  XP_003469423 Ensembl:  ENSCPOG00000036885 UniProt:  A0A286XV21 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MEEYHRHSDEVGFNADEAHNIIKECVDGVLGGEDYNQKNINQWTASIVEQTLAHLVKLGK AYKYIVTCAVVQRSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtaccaccgccacagcgacgaggtaggcttcaatgctgatgaggcccacaat atcatcaaagagtgtgtggatggggtgttaggaggtgaggattacaatcaaaagaatatc aatcagtggactgcaagcatagtggagcaaacacttgcacatttggttaagctggggaaa gcttacaaatacattgtgacttgtgcagtggtccagaggagtgcatatggctttcacaca gccagctcttgcttttgggacaccacatctgatggaacctgtaccgtaagatgggaaaat cgaaccatgaactgcattgtcaatgtttttgccattgcaattgtgctgtga

DBGET integrated database retrieval system