Cavia porcellus (domestic guinea pig): 100735368 Help Entry 100735368         CDS       T07777                                  Name (RefSeq) C-C motif chemokine 4   KO K12964   C-C motif chemokine 4 Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04060   Cytokine-cytokine receptor interaction cpoc04061   Viral protein interaction with cytokine and cytokine receptor cpoc04062   Chemokine signaling pathway cpoc04064   NF-kappa B signaling pathway cpoc04620   Toll-like receptor signaling pathway cpoc04623   Cytosolic DNA-sensing pathway cpoc05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100735368   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100735368    04061 Viral protein interaction with cytokine and cytokine receptor     100735368  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100735368    04623 Cytosolic DNA-sensing pathway     100735368    04062 Chemokine signaling pathway     100735368  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100735368  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cpoc04052]     100735368 Cytokines and neuropeptides [BR:cpoc04052]  Cytokines   Chemokines    100735368 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  100735368 NCBI-ProteinID:  XP_003469516 Ensembl:  ENSCPOG00000032867 UniProt:  A0A286X7F8 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search MKFYVTVLSLLVIGAAFCSPVLSAPIGSDPPTACCFTYTQRKLPRNFVTDYYETSSLCSQ PAVVFQTKRGKQVCANPSDSWVQEYVEYLELNEE NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaaattctacgtgactgtcctctctctccttgtgattggggctgccttctgctctcca gtgctttctgcaccaattggctcagaccctcccacagcctgctgcttcacttacacccag cggaagcttcctcgaaactttgtgactgattactatgaaaccagcagcctctgctcccag ccagctgtggtattccaaaccaaaaggggcaagcaagtctgtgccaaccccagtgattcc tgggttcaagagtatgtggaatacctagagctgaacgaggaatga

DBGET integrated database retrieval system