Cavia porcellus (domestic guinea pig): 101787241 Help Entry 101787241         CDS       T07777                                  Symbol Pfn3 Name (RefSeq) profilin-3   KO K05759   profilin Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04015   Rap1 signaling pathway cpoc04810   Regulation of actin cytoskeleton cpoc05014   Amyotrophic lateral sclerosis cpoc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101787241 (Pfn3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101787241 (Pfn3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101787241 (Pfn3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101787241 (Pfn3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cpoc04131]     101787241 (Pfn3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cpoc04812]     101787241 (Pfn3)    04147 Exosome [BR:cpoc04147]     101787241 (Pfn3) Membrane trafficking [BR:cpoc04131]  Others   Actin-binding proteins    Others     101787241 (Pfn3) Cytoskeleton proteins [BR:cpoc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101787241 (Pfn3) Exosome [BR:cpoc04147]  Exosomal proteins   Proteins found in most exosomes    101787241 (Pfn3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Terminase-T7_RNaseH-like Motif Other DBs NCBI-GeneID:  101787241 NCBI-ProteinID:  XP_023422262 Ensembl:  ENSCPOG00000022322 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MSDWKGFISGVLRDQSIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRQTFL QTGLSLAGRRCCVIRDYLLAKGDGVLDARTKGPDGRALCVGHTPRALLVLMGRRGVHGGM LNKKMHELICGLCKQGM NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgagcgactggaagggcttcatcagcggcgtgctgcgggaccagagcatcgatgacgtg gccatcgtgggccactcggacaatcgttgcgtgtgggcatcgcggccggggggcctactg gctgccatctccccgcaggaggttggcgtgctcacggggcccgaccggcaaaccttcctg cagactggcctgagcttggcgggccgccgctgctgtgtcatccgtgactacctactggcc aaaggggacggcgtgctggacgcgcgcaccaagggcccagacgggcgcgccctctgcgtt ggccacacgccgcgcgcgcttctcgtgctcatgggtcggcgtggcgtgcacgggggtatg ctcaataagaagatgcatgagctgatctgcgggctgtgcaagcagggcatgtag

DBGET integrated database retrieval system