Cavia porcellus (domestic guinea pig): 106024976 Help Entry 106024976         CDS       T07777                                  Name (RefSeq) metallothionein-2-like   KO K14739   metallothionein 1/2 Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04978   Mineral absorption Brite KEGG Orthology (KO) [BR:cpoc00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     106024976  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cpoc03019]     106024976    03029 Mitochondrial biogenesis [BR:cpoc03029]     106024976 Messenger RNA biogenesis [BR:cpoc03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      106024976 Mitochondrial biogenesis [BR:cpoc03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     106024976 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  106024976 NCBI-ProteinID:  XP_005004745 Ensembl:  ENSCPOG00000033531 UniProt:  A0A286XRC9 LinkDB All DBs Position Unknown AA seq 61 aa AA seqDB search MDPNCSCATDGSCTCTRSCKCSNCKCPSCKKSCCSCCPVSCAKCAQGCVCKEPSDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgcgccactgatggctcctgcacctgcacccgctcctgcaaa tgctcaaactgcaaatgcccctcctgcaagaagagctgctgctcttgctgcccagtgagc tgtgccaagtgtgcccagggctgtgtctgcaaagagccatcggacaagtgcagctgctgt gcctga

DBGET integrated database retrieval system