Cavia porcellus (domestic guinea pig): 111753283 Help Entry 111753283         CDS       T07777                                  Symbol Ccl27 Name (RefSeq) C-C motif chemokine 27   KO K16598   C-C motif chemokine 27 Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04060   Cytokine-cytokine receptor interaction cpoc04061   Viral protein interaction with cytokine and cytokine receptor cpoc04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     111753283 (Ccl27)    04061 Viral protein interaction with cytokine and cytokine receptor     111753283 (Ccl27)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     111753283 (Ccl27)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cpoc04052]     111753283 (Ccl27) Cytokines and neuropeptides [BR:cpoc04052]  Cytokines   Chemokines    111753283 (Ccl27) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 VMAP-M1 Motif Other DBs NCBI-GeneID:  111753283 NCBI-ProteinID:  XP_023421271 LinkDB All DBs Position Unknown AA seq 133 aa AA seqDB search MPQVKCSQIKGMGEGAERSKYQLRSMKELFLPTSILMLLLLLLSPDPGAASLLQPITTCC TQLYRRPLPNKILRKVIWVELQEADGDCHLQAFVLYLTERSVCVHPKNRSLIQWLERHGK RFQGTLRNPNLGL NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgccccaggtaaaatgctcacagataaaaggtatgggagaaggagcggagagaagcaaa tatcagctgagaagcatgaaggagctgtttttacccaccagcatcctcatgctgctgctg ctactcctgagcccagaccctggagcagcatcgctactgcagcccatcactacctgctgt acgcagctctacagacggccactcccaaacaagatactgaggaaggtcatctgggtagaa ctgcaggaggctgatggggactgtcacctccaggcttttgtgctttacctgactgagcgc agtgtctgtgtccaccccaagaatcgcagcctgattcagtggcttgagcgccatgggaaa aggttccaggggactctgcgcaacccaaatctggggctgtga

DBGET integrated database retrieval system