Chitinophaga pollutisoli: WJU16_19395 Help Entry WJU16_19395       CDS       T10245                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cpol  Chitinophaga pollutisoli Pathway cpol01100   Metabolic pathways cpol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cpol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WJU16_19395    00074 Mycolic acid biosynthesis     WJU16_19395   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WJU16_19395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  WZN40136 UniProt:  A0ABZ2YMK2 LinkDB All DBs Position 4565806..4566063 Genome browser AA seq 85 aa AA seqDB search MEIKEIIQKTNAFLAEEFEVSPESITPEADLKATLELDSLDYIDLVVAIENNFGFKVKPE DFQGIVTFQDFYDYVIERVKQKELV NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggaaatcaaggagatcattcaaaaaaccaatgcttttctggcggaagaattcgaagtt tcccccgagagcattacccccgaggccgatctgaaagccacgctggaactggacagcttg gactatatcgacctcgtagtagccattgagaacaatttcggattcaaagtgaaaccggag gatttccagggcatcgttacgttccaggatttttatgattatgttatcgaacgtgttaaa caaaaagaactggtataa

DBGET integrated database retrieval system