Cloacibacillus porcorum: BED41_06190 Help Entry BED41_06190       CDS       T04453                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cpor  Cloacibacillus porcorum Pathway cpor01100   Metabolic pathways cpor01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cpor00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BED41_06190    00074 Mycolic acid biosynthesis     BED41_06190   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BED41_06190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  ANZ44714 UniProt:  A0A1B2I413 LinkDB All DBs Position 1366363..1366614 Genome browser AA seq 83 aa AA seqDB search MKMEEVQSKLKEIVMDRLNAEEDQIKPEASFVEDLGADSLDIVELIMGIEEEFDIEIPDE DAEKLTTVGEAMEYVKTKLAVED NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaaaatggaagaagtacagagcaaacttaaggaaatcgtaatggaccgccttaacgcg gaagaggaccagatcaagccggaagcctcgtttgttgaagacctcggcgccgactcgctc gatatcgtcgagctcatcatgggaatcgaagaagaatttgacatcgagatccccgatgag gacgccgaaaagctgacgaccgtcggcgaggcgatggaatacgttaagacgaagcttgca gtcgaagactaa

DBGET integrated database retrieval system