Cloacibacillus porcorum: BED41_08365 Help Entry BED41_08365       CDS       T04453                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism cpor  Cloacibacillus porcorum Pathway cpor00020   Citrate cycle (TCA cycle) cpor00720   Other carbon fixation pathways cpor01100   Metabolic pathways cpor01110   Biosynthesis of secondary metabolites cpor01120   Microbial metabolism in diverse environments cpor01200   Carbon metabolism cpor01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:cpor00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     BED41_08365   09102 Energy metabolism    00720 Other carbon fixation pathways     BED41_08365 Enzymes [BR:cpor01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      BED41_08365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_10 Fer4_6 Fer4_21 Fer4_9 Fer4_2 Fer4_4 Fer4_16 Fer4_3 Fer4_8 Fer4_22 Fer4_13 Fer4_15 Fer4_17 NQRA_N Motif Other DBs NCBI-ProteinID:  ANZ45089 UniProt:  A0A1B2I540 LinkDB All DBs Position complement(1878857..1879057) Genome browser AA seq 66 aa AA seqDB search MAKKFNIDVVEKWCKGCGLCIAICPKKVLELNDQVKSVAVRPEDCIGCRQCENICPDLAI TVKECE NT seq 201 nt NT seq  +upstreamnt  +downstreamnt ttggcgaagaagttcaacatcgacgttgttgagaagtggtgtaaaggatgtggcctctgt atcgctatatgccccaagaaggttctggaacttaacgatcaggttaagagcgtagcggtt cgtccggaggactgcattggctgccgccagtgcgagaatatctgcccggacctggcaatc actgttaaggagtgtgaataa

DBGET integrated database retrieval system