Citrobacter portucalensis: FOB25_02580 Help Entry FOB25_02580       CDS       T06238                                  Symbol dinI Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism cpot  Citrobacter portucalensis Brite KEGG Orthology (KO) [BR:cpot00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:cpot03400]     FOB25_02580 (dinI) DNA repair and recombination proteins [BR:cpot03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     FOB25_02580 (dinI) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Motif Other DBs NCBI-ProteinID:  QET55376 LinkDB All DBs Position 518251..518496 Genome browser AA seq 81 aa AA seqDB search MRIEVTIAKTSPLPAGAIDALAGELSRRIQHHFPDNEGNVTVRYAGANNLSVIGATKEDK ERISEILQETWESADDWFINE NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgtattgaagtcactattgccaaaacttcacctttacctgccggtgcaattgacgca ctggcaggtgaactctcccgccgtattcagcaccattttccggataacgaaggtaacgtt accgtccgttatgccggcgcaaacaatctgtcggttattggcgcgaccaaagaggacaaa gaacgcatcagcgagatcctacaggaaacctgggaaagcgcggatgactggttcatcaac gaataa

DBGET integrated database retrieval system