Collimonas pratensis: CPter91_3707
Help
Entry
CPter91_3707 CDS
T04306
Name
(GenBank) universal stress family protein
KO
K07646
two-component system, OmpR family, sensor histidine kinase KdpD [EC:
2.7.13.3
]
Organism
cpra
Collimonas pratensis
Pathway
cpra02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
cpra00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
CPter91_3707
09180 Brite Hierarchies
09181 Protein families: metabolism
01001 Protein kinases [BR:
cpra01001
]
CPter91_3707
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
cpra02022
]
CPter91_3707
Enzymes [BR:
cpra01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.13 Protein-histidine kinases
2.7.13.3 histidine kinase
CPter91_3707
Protein kinases [BR:
cpra01001
]
Histidine kinases
OmpR family
CPter91_3707
Two-component system [BR:
cpra02022
]
OmpR family
KdpD-KdpE (potassium transport)
CPter91_3707
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
KdpD
DUF4118
HATPase_c
HisKA
GAF_3
Usp
AAA_30
ResIII
HATPase_c_2
AAA_22
Motif
Other DBs
NCBI-ProteinID:
AMP06028
UniProt:
A0A127Q7J1
LinkDB
All DBs
Position
complement(3824666..3827461)
Genome browser
AA seq
931 aa
AA seq
DB search
MSSPNPNGDLRPDPDALLAQLQVQESLAGRGKLRIYFGASAGVGKTYAMLSAAHKLHSEG
REVLAGVIESHGRAETAALLNGLELLPLKQVEYRDKQLPEFDLDAALQRKPSLILVDELA
HSNASGSRHPKRWQDVEELLNAGIDVFTTLNVQHLESLNDVVGGITGIRVAETLPDTVFD
AADEVVLVDLPADELLNRLRLGKVYKLPQAERASRNFFRKGNLIALRELALRRTADRLQG
DVQAYRIEKSIGAVWQTDAALLACIGPSPSAEHVVRSTARLATQLNAEWHAIYVETPKLQ
RLSSAKRERILKTLKLAQDLGATTAVLAGNDVAAAMAAYARSHNFSKMIIGRSQRQFFWQ
PSHAARIAAQASDIDLIEIGVPPVSAAAKEEDAAGRSFPRQLPKQSRIEWWGYGWALGVC
VLVTLLATPILPFFDLANIVMLYLLAEVLIAIRYGRGPAIFVALLSIASFDFFFVPPRFS
FAVSDFQYLLTFGVMLAVGLTITHLTTGLRYQARIASDREARSRALFEFARALSGVLQTE
QIFETSRQFLQRSFQAKTLLLVPDDAGRLQLPAVIPEDVANVAAALDMGIAQWAFDNASS
AGIGTDTLPASNYLYLPLVAPMRTRGVLAILPHSRRWILIPEQQQQLYTFATLTAIALER
VHYVEVAQDALVRMESERLRNSLLSALSHDLRTPLTALIGLSESLVLSKPPLQENQQVLA
SALHSEMLRMSALVTNLLDMARIQSGEVKLNLQWQPFEEVVGSALRASSSALQGHQIETR
VAHELPLICFDAVLIERVLCNLLENAAKYTPPGSHIVLAAAVNGRFLAVTVADDGPGLPS
GMEDAIFEKFTRGERESAKPGVGLGLAICRAIVEAHGGTIRARSADHGVGAEFIFTIPLG
TPPSMPDLEEHDLRTDVAAASAGNIGNTEKT
NT seq
2796 nt
NT seq
+upstream
nt +downstream
nt
atgtcttcacccaatccaaacggcgacctgcgtcccgacccggacgctctgctggcgcag
ctgcaagtgcaggagagcctggctgggcgcggcaagctgcgcatctatttcggcgcttcc
gctggcgtcggcaaaacctacgccatgctcagcgcggcgcataaactgcatagcgaggga
cgcgaggtgctggccggggtcatcgaaagccacggcagggcggaaaccgcagccttgctg
aacggcctggagctgctgccgctcaagcaggtggaataccgcgacaagcagctgccggag
ttcgacctggacgcagcgctgcagcgcaagccttcactgatcctggtcgacgaactggcg
cattcgaacgcttccggttcgcgccatccgaagcgctggcaggatgtagaagagttgctg
aacgccggcatcgatgtcttcaccaccctcaatgtgcagcatctggaaagcctgaacgac
gtggtgggcggcattaccggcatccgggtggcggaaaccctgccggatacggtgtttgat
gccgccgacgaagtggtgctggtggatttgccggccgatgaactgctcaaccggctcagg
cttggcaaggtgtacaagctgccgcaggcagaacgcgcctcgcgcaattttttccgcaag
ggcaatctgatcgcgctgcgcgagctggccttgcgccgcaccgccgaccgcttgcaaggc
gatgtccaggcctatcgcatcgaaaaatcgataggcgcggtgtggcaaaccgatgccgcg
ctgctagcttgcatcggcccttcgccgagcgcagagcatgtggtccgcagcacggcgcgg
ctggcgacccagttgaatgccgaatggcatgcgatttatgtcgagacgccgaaattgcag
cgcctgtcttcggccaagcgcgagcgcatcctgaagacgctcaagctggcgcaggatcta
ggggcgactacggcggtcctggcgggtaacgacgttgccgcagccatggccgcttatgca
cgcagccataatttttcaaagatgatcatcggccgcagccaacgccagtttttctggcag
ccgagccacgccgcccgcatcgcggcgcaggccagcgatatcgacctgatcgaaatcggc
gtgccgccggtcagcgccgccgccaaggaagaagacgccgccggccgcagttttccgcgc
cagttgcccaagcaaagccggatcgaatggtggggctacggctgggcgctcggtgtgtgt
gtgctggtcaccttgctggcgacgccgatactgccgtttttcgatctcgccaatatcgtg
atgctatatctgctggcggaagtcctgatcgccatccgctacggccgcgggccggccatt
tttgtcgccctgctgagcatcgcctctttcgatttctttttcgtgccgccgcgcttttcc
ttcgccgtcagcgatttccaatacctgctgactttcggcgtgatgctggcggtgggcttg
acgattacccacctgaccaccggactgcgctaccaggcccgcatcgcctctgaccgtgaa
gcacgttcgcgcgccttgttcgagttcgcgcgcgccttgtcgggcgtgctgcaaaccgag
cagattttcgaaaccagccgccagttcctgcagcgcagcttccaggccaagaccttgctg
ctggtgccggacgatgccggccgcctgcagctgccggcagtgataccggaagatgtcgcc
aacgttgccgccgctctcgatatgggcatcgcccaatgggccttcgacaatgccagcagc
gccggcatcggcaccgatactctgccggccagcaattacctgtacctgccgctggtggcg
ccgatgcgtacgcgcggcgtgctggcgatcctgccgcacagccggcgctggatcctgatt
ccggaacagcaacagcagttgtataccttcgccaccttgaccgcgattgcgctggagcgg
gtgcactatgtcgaagtggcgcaggacgcgctggtgcggatggaatcggaacgcttgcgt
aactccctgctgtcagcgctatcgcacgatctgcgtacgcctttgacggcgctgatcggc
ctgtccgaatcgctggtgctgtcgaagccgccgctgcaggagaaccagcaggtactggcg
agcgcactgcatagcgaaatgctgcgcatgagcgcactggtcaccaatctgctggacatg
gccaggatccagagcggcgaggtgaaattgaacttgcagtggcagccatttgaagaagtg
gtcggcagcgcgctgcgcgccagcagctcggcattgcaagggcatcagatagaaacacgg
gtagcgcatgagctgccgctgatctgcttcgacgcggtcctgatcgagcgcgtgctgtgc
aacctgctggaaaatgccgccaaatacacgccgcccggctcgcatatcgtgctggcggcg
gcggtcaacggccgattcctggcggtcaccgtagcggacgacggcccggggctgccgagc
ggcatggaagacgccatattcgagaaattcacacgcggcgagcgcgaatcggccaagccc
ggtgtcggtttggggctggcgatctgccgcgcgattgtcgaagcgcacggcggcaccatt
cgtgcccgcagcgccgaccatggcgttggtgcggaattcatctttaccatcccgctcggt
acgccgcccagcatgccagacctggaagagcacgacctcagaacggatgttgccgccgct
agtgccggcaatatcggcaacacggagaaaacatga
DBGET
integrated database retrieval system