KEGG   Anaerotignum propionicum: CPRO_08710
Entry
CPRO_08710        CDS       T04574                                 
Symbol
mmuM
Name
(GenBank) homocysteine S-methyltransferase
  KO
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
cpro  Anaerotignum propionicum
Pathway
cpro00270  Cysteine and methionine metabolism
cpro00670  One carbon pool by folate
cpro01100  Metabolic pathways
cpro01110  Biosynthesis of secondary metabolites
cpro04981  Folate transport and metabolism
Brite
KEGG Orthology (KO) [BR:cpro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CPRO_08710 (mmuM)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CPRO_08710 (mmuM)
 09150 Organismal Systems
  09154 Digestive system
   04981 Folate transport and metabolism
    CPRO_08710 (mmuM)
Enzymes [BR:cpro01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     CPRO_08710 (mmuM)
SSDB
Motif
Pfam: S-methyl_trans Peptidase_A2_2
Other DBs
NCBI-ProteinID: AMJ40471
UniProt: A0A0X8VCJ8
LinkDB
Position
875999..876937
AA seq 312 aa
MNPIERILAEYPLMILDGAFSTELERRGCDLNDPLWSAKVLMENPDMIGSVHEDYFKAGA
DCAITASYQATFAGFMRRGLTKQEAKELIQLSVSIATKVRDSFWADPVNRTNRPKPLVAA
SVGPYGAFVADGSEYRGNYGLTREGLEDFHRERMATLIEAKPDILACETIPCLIEAQAIV
NVLKEHPDISAWISFSAKDGTCINSGERIEDCARWLDGYPQVAAIGINCTAPEFVESLIL
EIRKGSNKPIIVYPNSGEQYDAVTKTWHGSSTGMCYGDIAKQWFEKGAKLIGGCCRTTPD
DIRQIALWGREL
NT seq 939 nt   +upstreamnt  +downstreamnt
atgaaccctattgaacgaattttggctgaatatccattgatgatattagatggagccttt
tccactgaactggaacggcggggctgtgacctgaatgatcccctttggtcggccaaggtt
ctcatggaaaatcctgatatgattggatctgtacatgaggattactttaaagcgggagct
gattgtgctatcactgccagttatcaagcgacgttcgcaggctttatgaggagagggctg
acgaagcaggaggcaaaggagctcattcaactttccgtgagcattgcaacgaaagtgagg
gatagcttttgggctgaccctgtaaataggacaaatcgacctaaaccgttagttgcggct
tctgtgggcccatacggtgcttttgttgctgatggttctgagtatcgaggaaattatgga
ctgaccagagagggattggaagattttcaccgagaaagaatggcaacattgattgaagcg
aagccggatatattggcctgtgaaacgattccttgcttgattgaggcgcaggcaattgtg
aatgttttaaaagaacatcctgatatatcggcatggataagctttagtgccaaggacggc
acttgcattaatagtggagagcggatagaggactgtgcccgttggctggatggatatccc
caagtggcggctattggtataaactgcacggcacctgaatttgtggagtcacttatttta
gaaatccgtaagggttcaaataagcccatcattgtttatccaaattcgggagagcaatat
gatgcagtaacaaaaacttggcatggcagttcaacaggaatgtgttacggtgatattgcc
aagcagtggttcgaaaagggtgctaaactgattggtggttgttgcagaacaacgcctgat
gatattcgtcagattgcactttggggaagagaattataa

DBGET integrated database retrieval system