KEGG   Cellulosimicrobium protaetiae: FIC82_009220
Entry
FIC82_009220      CDS       T08736                                 
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
cprt  Cellulosimicrobium protaetiae
Pathway
cprt00770  Pantothenate and CoA biosynthesis
cprt01100  Metabolic pathways
cprt01240  Biosynthesis of cofactors
Module
cprt_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:cprt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    FIC82_009220 (coaD)
Enzymes [BR:cprt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     FIC82_009220 (coaD)
SSDB
Motif
Pfam: CTP_transf_like
Other DBs
NCBI-ProteinID: QJW36344
UniProt: A0A6M5UEB0
LinkDB
Position
2205309..2205809
AA seq 166 aa
MTTAVCPGSFDPITLGHLDIVRRARVLFDDVVVGVARNASKSALLSVDERVALARAAVDG
AGLDGVRVEVVPGLLVDFCREVGAGAVVKGLRGGADFDAELPMALMNRHLAGVETVFVAG
DAALLHVASSLVKDIARYGGPVDDLVPPGVGDAVRAALARVQGSSR
NT seq 501 nt   +upstreamnt  +downstreamnt
gtgaccacagccgtctgtcccgggtcgttcgacccgatcaccctgggccacctcgacatc
gtccgacgcgcccgcgtgctcttcgacgacgtcgtcgtcggcgtcgcgcggaacgcgtcg
aagtcggcgctgctgagcgtcgacgagcgcgtcgcgctggctcgtgccgcggtcgacggc
gccgggctggacggtgtccgtgtggaggtcgtgccggggctcctggtggacttctgccgg
gaggtcggcgcgggcgccgtggtcaagggtctgcgcggtggcgcggacttcgacgccgag
ctgccgatggcgctcatgaaccgccacctggctggcgtcgagaccgtgttcgtcgcggga
gacgccgcgctgctgcacgtcgcgtcgtcgctcgtgaaggacatcgcgcgatacggggga
ccggtcgacgacctggtcccaccgggggtgggtgacgccgtccgtgcggcgctggcacgg
gtgcaggggagcagcaggtga

DBGET integrated database retrieval system