Cellulosimicrobium protaetiae: FIC82_009995 Help Entry FIC82_009995      CDS       T08736                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cprt  Cellulosimicrobium protaetiae Pathway cprt01100   Metabolic pathways cprt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cprt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FIC82_009995    00074 Mycolic acid biosynthesis     FIC82_009995   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FIC82_009995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 Motif Other DBs NCBI-ProteinID:  QJW36474 UniProt:  A0A6M5UEL9 LinkDB All DBs Position complement(2370935..2371183) Genome browser AA seq 82 aa AA seqDB search MAYTEQEVLAGLAEIVAEETGLPTDAVALEKSFTDDLDIDSLSMMTIVTHAEDKFGVRIP DDEVKNLATVGDAVSFITGAQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcttacaccgagcaggaagtcctcgccggcctcgcggagatcgtcgccgaggagacg ggtctgccgaccgacgccgtcgcgctcgagaagtccttcaccgacgacctcgacatcgac tcgctgtcgatgatgacgatcgtcacgcacgccgaggacaagttcggggtccgcatcccg gacgacgaggtcaagaacctcgcgacggtcggcgacgccgtgtccttcatcacgggcgcc caggcctga

DBGET integrated database retrieval system