Chlamydia psittaci WC: B603_0538 Help Entry B603_0538         CDS       T02313                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cpsw  Chlamydia psittaci WC Pathway cpsw01100   Metabolic pathways cpsw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cpsw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B603_0538 (acpP)    00074 Mycolic acid biosynthesis     B603_0538 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B603_0538 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Clr5 Motif Other DBs NCBI-ProteinID:  AFS26315 LinkDB All DBs Position 552005..552241 Genome browser AA seq 78 aa AA seqDB search MSLEDDVKAIIVEQLGVDPSEVNENSSFIEDLNADSLDLTELIMTLEEKFNFEISEQDAE KLRTVGDVLTYIKTRQGQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtttagaagatgatgtaaaggcaattattgttgagcaacttggggtagatccaagt gaggtaaatgagaattcttcatttatcgaggatcttaatgctgatagtttagacttaaca gagttgattatgactttagaagaaaagtttaactttgaaatttcagaacaagatgcagaa aaattacgtactgtaggcgacgttctcacatatattaaaacacgtcagggccagtag

DBGET integrated database retrieval system