Coniophora puteana: CONPUDRAFT_108178 Help Entry CONPUDRAFT_108178 CDS       T03134                                  Name (RefSeq) Sm-like ribonucleo protein   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism cput  Coniophora puteana Pathway cput03018   RNA degradation cput03040   Spliceosome Brite KEGG Orthology (KO) [BR:cput00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     CONPUDRAFT_108178   09123 Folding, sorting and degradation    03018 RNA degradation     CONPUDRAFT_108178  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cput03019]     CONPUDRAFT_108178    03041 Spliceosome [BR:cput03041]     CONPUDRAFT_108178 Messenger RNA biogenesis [BR:cput03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      CONPUDRAFT_108178   mRNA degradation factors    5'-3' decay     Lsm complex      CONPUDRAFT_108178 Spliceosome [BR:cput03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     CONPUDRAFT_108178 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM DUF7510 Motif Other DBs NCBI-GeneID:  19198693 NCBI-ProteinID:  XP_007771389 JGI:  Conpu1_108178 UniProt:  A0A5M3MH53 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MSSLQGYVDHRVLLVLQDGRSIVGVLAGFDQKANVVLSDSKERVYSLEEGVEEIPLGLYL VKGDMIVLIGEIDDAVDSSVDLSTIRAEPIPPIRY NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgtccagcttgcagggatatgtcgatcaccgcgtactcctcgtcctccaagatggccgc tccattgtaggagtcctggctggttttgatcaaaaagcgaatgtagtcctttctgactcg aaagaacgcgtgtacagtcttgaggagggcgtagaagagataccattgggcctctacctg gtgaaaggtgacatgatcgtccttattggcgagatcgatgatgcagtagactcatctgtc gacctctcgactatccgtgccgagcccattccaccaatccggtactga

DBGET integrated database retrieval system