Coniophora puteana: CONPUDRAFT_116112 Help Entry CONPUDRAFT_116112 CDS       T03134                                  Name (RefSeq) RNA polymerase Rpb6   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism cput  Coniophora puteana Pathway cput03020   RNA polymerase cput03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cput00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     CONPUDRAFT_116112   09124 Replication and repair    03420 Nucleotide excision repair     CONPUDRAFT_116112  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cput03021]     CONPUDRAFT_116112    03400 DNA repair and recombination proteins [BR:cput03400]     CONPUDRAFT_116112 Transcription machinery [BR:cput03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      CONPUDRAFT_116112   RNA polymerase III system    RNA polymerase III      CONPUDRAFT_116112   RNA polymerase I system    RNA polymerase I      CONPUDRAFT_116112 DNA repair and recombination proteins [BR:cput03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       CONPUDRAFT_116112 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  19199211 NCBI-ProteinID:  XP_007763675 JGI:  Conpu1_116112 UniProt:  A0A5M3N6X7 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MNGVNGMDHDQEMANGEAAQPEQSAVPTSGERQANKERITTPYLTKYERARILGTRALQI SMNAPVLVPLDGETDALQIAIKELSQRKIPLIIRRYLPDGSFEDWSVSELISD NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgaatggcgtaaacggcatggaccatgaccaggagatggccaatggagaggctgctcag ccagaacaatcggccgtacctacgagcggcgaacggcaggccaacaaagagcgcatcacg acaccttacttgaccaagtacgagcgtgcacgaatattgggtaccagagccttgcaaatc agcatgaacgctccggtactcgtcccgctcgatggtgagacggatgctttacaaatagca ataaaagaactttctcaacgaaaaataccacttatcatccgacggtacttgccagacggc agcttcgaagattggagtgtttccgagctcattagtgactag

DBGET integrated database retrieval system