Coniophora puteana: CONPUDRAFT_149340 Help Entry CONPUDRAFT_149340 CDS       T03134                                  Name (RefSeq) hypothetical protein   KO K10991   DNA repair protein Swi5/Sae3 Organism cput  Coniophora puteana Brite KEGG Orthology (KO) [BR:cput00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:cput03400]     CONPUDRAFT_149340 DNA repair and recombination proteins [BR:cput03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      CONPUDRAFT_149340 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Swi5 Seryl_tRNA_N DUF7365 Occludin_ELL MTR4-like_stalk DUF4140 Motif Other DBs NCBI-GeneID:  19202580 NCBI-ProteinID:  XP_007763843 JGI:  Conpu1_149340 UniProt:  A0A5M3N792 LinkDB All DBs Position Unknown AA seq 85 aa AA seqDB search MYASFSEEAQKNRLEQLQAEVNELQKTLGENKNAERIVANHIQLLHRYNEAKDAAQILIG RLANLKGTTVRQIHEDMDLLDDDKT NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgtacgcttcattctcagaagaggcccagaagaaccgcctcgaacagctacaagccgag gtcaacgagctgcagaaaacactaggggaaaacaagaacgctgagaggatagtggccaat catatccagctcctgcaccgctacaacgaggccaaggacgctgcccagatcttgataggc aggcttgctaacctaaagggaacgaccgttcgacagattcacgaagacatggacttgctc gacgacgacaaaacctga

DBGET integrated database retrieval system