Coniophora puteana: CONPUDRAFT_59447 Help Entry CONPUDRAFT_59447  CDS       T03134                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism cput  Coniophora puteana Pathway cput04145   Phagocytosis cput04517   IgSF CAM signaling cput04814   Motor proteins Brite KEGG Orthology (KO) [BR:cput00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     CONPUDRAFT_59447  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     CONPUDRAFT_59447   09142 Cell motility    04814 Motor proteins     CONPUDRAFT_59447  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cput03037]     CONPUDRAFT_59447    04812 Cytoskeleton proteins [BR:cput04812]     CONPUDRAFT_59447 Cilium and associated proteins [BR:cput03037]  Motile cilia and associated proteins   Dynein arm    CONPUDRAFT_59447 Cytoskeleton proteins [BR:cput04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      CONPUDRAFT_59447 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  19208035 NCBI-ProteinID:  XP_007770449 JGI:  Conpu1_59447 UniProt:  A0A5M3MK26 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search MSEEMQQESVDIASAALEKYNIEKDIAAHIKKEFDRRHGATWHVVVGKNFGSYVTHETKH FIYFYVGSLAILIWKS NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagcgaggagatgcagcaagagagtgtcgacattgcgtcggctgctctcgagaagtac aatattgagaaggatatcgctgcgcacatcaagaaggagttcgacaggcgacatggcgcg acatggcatgtcgtggtaggcaagaactttggaagctacgtgactcatgaaaccaagcac tttatctacttctatgtcgggtctcttgcgatccttatctggaagtcatga

DBGET integrated database retrieval system