Coniophora puteana: CONPUDRAFT_90969 Help Entry CONPUDRAFT_90969  CDS       T03134                                  Name (RefSeq) hypothetical protein   KO K03017   DNA-directed RNA polymerase II subunit RPB9 Organism cput  Coniophora puteana Pathway cput03020   RNA polymerase cput03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cput00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     CONPUDRAFT_90969   09124 Replication and repair    03420 Nucleotide excision repair     CONPUDRAFT_90969  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cput03021]     CONPUDRAFT_90969    03400 DNA repair and recombination proteins [BR:cput03400]     CONPUDRAFT_90969 Transcription machinery [BR:cput03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol II specific subunits      CONPUDRAFT_90969 DNA repair and recombination proteins [BR:cput03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       CONPUDRAFT_90969 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Zn_ribbon_TFIIS Zn_ribbon_RPB9 Zn_ribbon_InsA DUF7459 Zn_ribbon_Elf1 zf_UBZ C1_1 zf-C2H2 Lar_restr_allev zf-CHY HVO_0758 Motif Other DBs NCBI-GeneID:  19211428 NCBI-ProteinID:  XP_007770004 JGI:  Conpu1_90969 UniProt:  A0A5M3MK77 LinkDB All DBs Position Unknown AA seq 123 aa AA seqDB search MASLHFCSECNNLLYPKADPARRNMVYACRICTYDEDVDNACVYRNDLLTVTKEQKGVVT DLGTDPTLAHSNIPCPRCHNEDAVYFQDQSKRKETRMILFFVCSKCNESFSDPSLPQDAR PEM NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggcctctcttcacttctgctcggaatgcaacaacctactctaccccaaggctgacccg gcgcggcgcaacatggtgtacgcatgccgcatctgcacctatgatgaggacgtggacaat gcgtgtgtgtaccggaatgacttgctcacggtgacgaaagagcagaagggtgtcgtcacg gaccttggcacggatccaacgctggcacactccaacatcccatgtccgcgctgccacaac gaagatgccgtgtacttccaggaccagtcgaagcggaaggaaacacggatgatcctcttc ttcgtgtgttcaaagtgtaatgaaagcttctcagatccatcactaccacaagatgcaaga ccagagatgtga

DBGET integrated database retrieval system