Cryptosporidium parvum: cgd8_980 Help Entry cgd8_980          CDS       T00168                                  Name (RefSeq) hypothetical protein   KO K02183   calmodulin Organism cpv  Cryptosporidium parvum Pathway cpv04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:cpv00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     cgd8_980  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cpv01009]     cgd8_980   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cpv04131]     cgd8_980    03036 Chromosome and associated proteins [BR:cpv03036]     cgd8_980   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cpv04147]     cgd8_980 Protein phosphatases and associated proteins [BR:cpv01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      cgd8_980 Membrane trafficking [BR:cpv04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     cgd8_980 Chromosome and associated proteins [BR:cpv03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      cgd8_980 Exosome [BR:cpv04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    cgd8_980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_9 DUF6852 EF-hand_1 Motif Other DBs NCBI-GeneID:  3374634 NCBI-ProteinID:  XP_627006 ApiDB_CryptoDB:  cgd8_980 UniProt:  Q5CWB3 LinkDB All DBs Position 8:269694..269924 Genome browser AA seq 76 aa AA seqDB search IKKFLLLAMLGLGSKEVDFQTYLDLVSHKVMLKADKEELRTAFNVLDRYGNGKVLVSDLK HILCNIGEKLTVSYIN NT seq 231 nt NT seq  +upstreamnt  +downstreamnt ataaaaaaattcttattactcgcaatgttaggacttggttcaaaggaagtcgatttccag acatatctcgatttagtatctcataaagttatgttaaaggctgataaggaagagttaaga actgcctttaatgttttggatagatatggaaatggtaaagttttggttagtgatttgaaa catattttgtgtaatattggagagaaattgactgtaagttacataaattaa

DBGET integrated database retrieval system